Loading...
HomeMy WebLinkAboutApplication and Supporting DocumentsCity of Miami Planning Departnrnt & Office of Zoning httpl/www.nianigov.com'planning httpl/www.nianigov.com'zoning E-naiE eplanp crmiamigov.com Planning (305) 416-1400 Zoning (305) 416-1495 Development Agreement Application Request Number PZ-25-20097 SUBMITTER INFORMATION First Name: Email: Javier Last Name: jfernandez@s ugglaw.com Fernandez PRIMARY APPLICANT INFORMATION First Name: Javier Corporation: SMGQ Law Adch-ess: 201 Alhambra Circle City: Coral Gables Email: jfernandez@smgqlaw.com smgglaw.com Last Name: Femandez State: Phone: Florida Tip: 3057612274 33134 PRIMARY OWNER INFORMATION First Name: Corporation: Coconut Grove Condo, LLC Address: 121 Alhambra Plaza City: Coral Gables Email: HMayoft@allerumms.com Last Name: State: Phone: Florida hp: 3054431000 33134 PROJECT INFORMATION Project Name: Project Address: City: Master Folio Number. Ziggurat Development Agreement 3101 GRAND AV Miami 0141210300020 State: Florida Unit Number: hp: 33133 SIGNATURE That under the penalty of perjury, I declare that all the information contained in this permit application is accurate to the best of my knowledge. • That NO work or installation w> 1 commence prior to the issuance of a building permit and that all work w> 1 be performed to meet the standards of all laws regulating construction and zoning in this jurisdiction • I will, in all respects, perform work in accordance with the scope of the permit, the City of Miami's codes and all other applicable laws, regulations, standard and ordinances. • That all infomiition given will be accurate and that all work w]Il be done in compliance with all applicable laws regulating construction and zoning • That separate permits maybe required unless specifically covered with the submittal of this application. • That there may be additional permits required from other entities. • Fees shall be paid prior to the review and issuance of the permit, as necessary. • Permit fees are non-refundable APPLICANT OWNER / OWNER REPRESENTATIVE First Name: Signature: Date: Javier Last Name: Fernandez 10/27/2025 First Name: Signature: Date: Javier Last Name: Fernandez 10/27/2025 ACKNOWLEDGEMENT r�^�/w���vv�—`—����^—.m^—.� / ^� / APPLICANT ^—.^���.n / 1. The Department of Resilience and Public Works, Transportation, Coordinated Review Committee and other City and County agencies review zoning public hearing requests and provide input, which may affect the scheduling and outcome of my hearing. These reviews may require additional hearings before other City and County boards, which may result in the modification of plans, studies and/or the proffering of agreements to be recorded. The submission and acceptance of a request for public hearing means that the application is ready to be scheduled for public hearing. | am also aware that | must comply promptly with any City or County conditions and notify the Hearing Boards (Hearing Boards) in writing if my public hearing application will be withdrawn. 2� Filing fees may not bethe total cost ofahearing. Some requests require notices tobemailed boproperty owners up to a mile from the subject property and I am responsible for paying the additional radius mailing costs. In addition to mailing costs, I am responsible for additional fees related to application changes, plan revioionm, defena|o, re+advertioing, etc. that may be incurred. | understand that fees must be paid promptly. The only fees that will berefunded nftertheoubmiuoionandacceptonceofonapp|icntionfurpub|ichaahnghaa occurred will be the surcharge fees related to appeals, as expressly listed in Chapter 62 of the City Code 3. Requests for public hearing will be scheduled by the Hearing Boards in accordance with the scheduling timeline set forth in the Code and the Zoning Ordinance of the City of Miami (Miami 21), as applicable. I must submit any requests to reschedule, continue or defer my hearing date to the attention of the decision -making body for its consideration and vote at the public hearing on which my application is scheduled to be heard. | understand that any requests by the applicant to reschedule, continue or defer the hearing date that are granted shall incur a $1.0UO.00fee, ooper the Code. 4` Applicable Florida Building Code requirements, or other applicable requirements, may affectmyability hoobtain a building permit even if my zoning application is approved; and a building permit will probably be required. I am responsible for obtaining any required permits and inspections for all structures and additions proposed, or built, without permits. In addition, a Certificate of Use (C.U.) must be obtained for the use of the property after it has been approved at a zoning public hearing. Failure to obtain the required permits and/or C.U., Certificates of Completion (C.Cj, or Certificate of Occupancy (C.O.) will result in an enforcement action against any occupant and owner. Submittal of the zoning public hearing request may not forestall enforcement action against the E If my request is denied, dafernad, or otherwise not approved, | understand that | will not be reimbursed for any fees paid. G. Any requests by the applicant to reschedule, continue or defer the hearing date that are granted shall incur a $1,000.00 fee, as per the Code. 7 Any covenant to be voluntarily proffered must be submitted in word format to the Planning Department and to the Office of the City Attorney through eP|on for review and comments from the Planning Department, Office of the City Attorney, and any other City departments as deemed necessary. The covenant will be reviewed in eP|an and the applicant will be notified of any necessary changes, corrections orcomments through eP|an. Once the covenant receives a recommendation of approval from the Planning department and as to legal form, Hearing Boards staff will extract the approved covenant directly from oP|an to include as part of the agenda. The applicant is responsible to submit to the Hearing Boards the signed covenant with a current Opinion of Title no|oterthanhwn(2)weekoprinrtotheinibe|pub|ichaoring.|underotandthetonynequostsbytheapp|icontto reschedule, continue or defer the hearing date that are granted shall incur a $1,000.00 fee, per instance, as per the Code. Acknowledgment Applicant 8. Any and all documents submitted must be accompanied by a cover letter indicating the subject matter, application number and hearing date. ._fayi McC Applicant(s) Name Printed Applicant(s) SignatiYre and Date STATE OF FLORIDA COUNTY OF MIAMI-DADE The foregoing instrument was acknowledged before me by means of 2/physical presence or ❑ online L notarization, this iO X 2+ , 20 ' by Aiwa a E : 1 n CA Y)ddC (name of person acknowledging), who is personally known to me or who has produced as identification. [Notary Seal] KAREN S. ALVARADO MY COMMISSION # HH 443350 EXPIRES: October 9, 2027 i Oren AIULIYciCI Name typed, printed or stamped My Commission Expires: STATE OF FLORIDA COUNTY OF MIAMI-DADE The foregoing instrument was acknowledged before me by means of ❑ physical presence or ❑ online notarization, this , 20 by (name of officer or agent, title of officer or agent), of (name of corporation acknowledging), a State of Florida corporation, on behalf of the corporation. He/she is personally known to me or has produced as identification. [Notary Seal] Notary Public Name typed, printed or stamped My Commission Expires: Acknowledgment by Applicant Updated 08.13.2020 Page 2 of 4 STATE <3FFLORIDA COUNTY OFK8N4MI-DADG The foregoing instrument was acknowledged before mebymeans ofUphysical presence orOonline notarization, this .20__ by (name of member, manoger, officer or agent, title of member, manager, officer orogent). of (name ofcompany ncknmw|edging).oState of Florida limited liability compeny, on behalf nfthe company, who is personally known to me or has produced as identification. [Notary Seal] Notary Public Name typed, printed orstamped My Commission Expires: STATE OF FLORIDA COUNTY OF MIAMI-DADE The foregoing instrument was acknowledged before mebymeans ufOphysical presence orOonline notarization, this .20 by (name of acknowledging partner nregent).partner (or agent) onbehalf of (name of partnership), a partnership. He/she is personally known to me or has produced as identification. [Notary Seal] Notary Public Name typed, printed orstamped My Commission Expires: Acknowledgment by Applicant STATE OF FLORIDA COUNTY OF MIAMI-DADE The foregoing instrument was acknowledged before meby means ofOphysical presence orOonline notarization, this .20 by (name cfattorney in fact) auattorney infact, who iopersonally known tomeurwho has produced aoidentification onbehalf of (name ofphnnipa|). (Notary Seal] Notary Public Name typed, printed orstamped MyCommission Expires: STATE OF FLORIDA COUNTY OF MIAMI-DADE The foregoing instrument was acknowledged before me by means of 0 physical presence or 0 online notarization, this 120 by (name and title of posbion).who ispersonally known tomeorwho has produced as identification. [Notary Seal] Notary Public Name typed, printed or stamped My Commission Expires: Acknowledgment uyApplicant upuotedne.1n.cn2n Page *m4 Note: Annual Registration Expires on 12/31/2024 CITY OF MIAMI LOBBYIST REGISTRATION FORM Instructions: Please complete all sections of this form and submit the completed form, with the applicable fee(s), to the Office of the City Clerk. If you need more space to complete a section, use a separate sheet(s) of paper. If you have nothing to report in a particular section, you must type or print "None" or "N/A" in that section. IF ANY SECTION IS LEFT BLANK, THE FORM WILL NOT BE ACCEPTED. Important: It is the responsibility of the lobbyist to ensure that ALL active lobbyist registration forms, including active lobbyist registration forms submitted in previous years, remain up to date. (1) Lobbyist Name: Fernandez, Javier E. (Last Name, First Name, Middle Initial) Business Phone: (305) 761-2274 Email: jfernandez@smgqlaw.com Business Address (include Zip Code): SMGQ Law 201 Alhambra Circle, Ste. 1205, Coral Gables, FL 33134 (2) Principal Represented: Coconut Grove Condo, LLC (Name of corporation, partnership, trust, etc., you are representing) Business Address (include Zip Code): 121 Alhambra Plaza, Ste. 1600 Coral Gables, FL 33134 Are you the Principal of the corporation, partnership, trust, etc.? YES NO (you must check YES or NO) NOTE: Principal means the person, firm, corporation, or other entity that performs lobbying activity on behalf of itself or that has designated, employed, or retained a lobbyist to lobby on its behalf. The term "principal" also includes the person, fine, corporation, or other entity receiving the benefit of the lobbying effort and on whose behalf the lobbyist is lobbying, even if the lobbyist is retained, engaged, or employed by a third -party for such purposes. (3) IF YOU PROVIDED INFORMATION IN SECTION 2 ABOVE, PLEASE REVIEW THIS SECTION CAREFULLY. If a lobbyist represents a corporation, partnership or trust, the lobbyist must disclose the name and business address of the chief officer, partner or beneficiary of the corporation, partnership or trust, and the names and addresses of all persons holding, directly or indirectly, at least five percent (5%) ownership interest in said corporation, partnership or trust. Attach separate sheet if needed. If this section is not applicable you must type or print "None" or "N/A". See attached (4) Specific issue associated with lobbying. Describe with as much detail as is practical. Attach a separate sheet if needed. If you are using this form for your Annual Registration, please write "Annual Registration" and the year that you are registering for (ex: Annual Registration 2024). Development Agreement for Project at 3101 Grand Avenue Page 1 of 2 Office of the City Clerk, 3500 Pan American Drive, Miami, FL 33133 / Phone: (305) 250-5361 / Email: clerks@miamigov.com CM-LRF (Rev. 12/2023) (5) Lobbyists shall be required to state the existence of any direct or indirect business association, partnership, or financial relationship with the Mayor, any member of the City Commission, any member of a City board, the City Manager or a member of the City staff before whom he/she lobbies or intends to lobby. Attach separate sheet if needed. If this section is not applicable you must type or print "None" or "N/A". None Lobbyists, as defined in City Code Section 2-653, shall pay an annual registration fee of $525.00, plus $105.00 for each principal represented for each issue lobbied on behalf of any one principal. Each issue associated with lobbying shall be described with as much detail as is practical. The City Clerk, or the City Clerk's designee, shall reject any registration statement that does not provide a clear description of the specific issue on which such lobbyist has been retained to lobby or if any section of this form is left blank. Regardless of the date of the annual registration, all lobbyists' annual registrations shall expire December 31 of each calendar year and shall be renewed on a calendar year basis. Each lobbyist shall, within sixty (60) days after registering as a lobbyist, submit to the Office of the City Clerk a certificate of completion of an ethics course offered by the Miami -Dade County Commission on Ethics & Public Trust ("Ethics Commission"). Lobbyists who have completed the initial ethics course mandated by the preceding sentence and have continuously registered as a lobbyist thereafter shall be required to complete a refresher ethics course offered by the Ethics Commission every two (2) years. Each lobbyist who has completed a refresher ethics course shall submit a certificate of completion within sixty (60) days after registering as a lobbyist. Lobbyists shall file amendments to their registration forms within fifteen (15) days of any change of information required to be set forth on their registration forms. (Miami -Dade County Code Section 2-11.1(s)(3)(h)) Each lobbyist shall file a form with the City Clerk within thirty (30) days after ceasing all lobbying activities with a principal. (Miami -Dade County Code Section 2-11.1(s)(3)(i)) I do solemnly swear that all of the foregoing facts are true and correct, and I have read or am familiar with the provisions contained in Chapter 2, Article VI, Sections 2-651 through 2-658 of the Miami City Code, as amended, and Miami -Dade County Code Section 2-11.1(s). STATE OF floriciCa COUNTY OF i � 0 (11 -- o Sworn to (or affirmed) and subscribed before me by means of physical presence or of 0lA O be,1 , 2-07 , by (Month) (Year) o.../tdr.J.tv2.( 006-) `Signature of Notary Public Personally Known: /Si nattwe ofLobbyist g Y online notarization, this 2 day JC>IV) 4.ernordc OR Produced Identification: (Name of person making statement) Type of Identification Produced: Name of Notary Type►~17,,r d� ipe '' '`fieKAREN S. ALVARADO MY COMMISSION # E ;!�ot� EXPIRES:October 9, 20027� •I.�F,h... (NOTA FOR OFFICE USE ONLY: Check # Receipt # CM-LRF (Rev. 12/2023) Page 2 of 2 AFFIDAVIT OF AUTHORITY TO ACT Before me this day, the undersigned personally appeared Javier E. Fernandez who being by me first deposes and says: 1. That he/she is the owner or the legal representative of the owner, submitting the public hearing application as required by the Code of the City of Miami, Florida, affecting the real property located in the City of Miami, as listed on the foregoing pages. 2. That all owners who he/she represents, if any, have given his/her full and complete permission for him/her to act in his/her behalf for the change or modification of a classification or regulation of zoning as set out in the foregoing petition, 0 including or 0 not including responses to day-to-day City staff inquires. 3. That the foregoing and following pages are part of this affidavit and contain the current names, mailing addresses, telephone numbers and legal descriptions of the real property of which he/she is the owner or legal representative. 4. That the facts, as represented in the application and documents submitted in conjunction with this affidavit, are true and correct. 5. That a refund, if any, by the City is to be issued to the following person at the address indicated: .zO I c/o SMGQ Law, 424-Alhambra Circle, Ste. 1205, Coral Gables, FL 33134 Further Affiant sayeth not. Javier E. Fernandez Applicant(s) Name Printed ApplicantsrSiglature STATE OF FLORIDA -- COUNTY OF MIAMI-DADE `^n,/ The foregoing was acknowledged before me this 2 + day of (7 � ! 1e 20 s `":> , by ) l.!:\ tI -} (_ i' who is a(n) individual/partner/agent/corporation of a(n) individual/partnership/corporation. He/She is ersonall known to me or 0 who has produced as identification and who e did 0 did not take an oath. (Stamp) KAREN S. ALVARADO MY COMMISSION # HH 443350 1`EXPIRES: October 9, 2027 Signature Rev. 10-18 CITY OFMIAMI DISCLOSURE OF CONSIDERATION PROVIDED OR COMMITTED FOR AGREEMENT TO SUPPORT OR WITHHOLD OBJECTION The City of Miami requires any person or entity requesting approval relief or other action from the City Commission or any of its boards, authorities, agencies, councils or committees, to disclose at the commencement (or continuance) of the hearing(s) on the issue, any consideration provided or committed, directly or on its behalf, to any entity or person for an agreement to support or withhold objection to the requested approval, relief or action. "Consideration" includes any gift, payment, contribution, donation, fee, commission, promise or grant of any money, property, service, credit or financial assistance of any kind or value, whether direct or implied, or any promise or agreement to provide any of the foregoing in the future. Individuals retained or employed by a principal as a lobbyist as defined in Sec. 2- 653, and appearing before the City Commission or any of its boards, authorities, agencies, councils or committees solely in the capacity of a lobbyist and not as the applicant, or owners' legal representative are not required to fill out this form. Name: First Name: Javier Middle Name: E Last Name: Fernandez Home Address: Home Address Line 1: Home Address Line 2: City: State: Florida Zip: Contact Information: Home Phone Number: Cell Phone Number: (305) 761-2274 Fax Number: Email: jfernandez@snigglaw.com BUSSINESS or APPLICANT or ENTITY NAME Address Line Coconut Grove Condo LLC 1: Address Line 2: 121 Alhambra Plaza, Ste. 1600, Coral Gables, FL 33134 Doc. No.:86543 Page 1 of 3 CITY OFMIAMI DISCLOSURE OF CONSIDERATION PROVIDED OR COMMITTED FOR AGREEMENT TO SUPPORT OR WITHHOLD OBJECTION Please describe the issue for which you are seeking approval, relief or other action from the City Commission, board, authority, agency, council, or committee. Development Agreement for Project at 3101 Grand Avenue. Has any consideration been provided or committed, directly or on your behalf, to any entity or person for an agreement to support or withhold objection to the requested approval, relief or action? No If your answer to Question 2 is No, do not answer questions 3, 4 & 5 proceed to read and execute the Acknowledgment. If your answer to Question 2 is Yes, please answer questions 3, 4 & 5 and read and execute the Acknowledgement. 1. Please provide the name, address and phone number of the person(s) or entities to whom consideration has been provided or committed. Name of Person/Entity: Phone Number of Person/Entity: Address of Person/Entity: 2. Please describe the nature of the consideration 3. Describe what is being requested in exchange for the consideration. Doc. No.:86543 Page 2 of 3 CITY OFMIAMI DISCLOSURE OF CONSIDERATION PROVIDED OR COMMITTED FOR AGREEMENT TO SUPPORT OR WITHHOLD OBJECTION ACKNOWLEDGEMENT OF COMPLIANCE I hereby acknowledge that it is unlawful to employ any device, scheme or artifice to circumvent the disclosure requirements of Ordinance 12918 and such circumvention shall be deemed a violation of the Ordinance; and that in addition to the criminal or civil penalties that may be imposed under the City Code, upon determination by the City Commission that the foregoing disclosure requirement was not fully and timely satisfied the following may occur: 1. the application or order, as applicable, shall be deemed void without further force or effect; and 2. no application from any person or entity for the same issue shall be reviewed or considered by the applicable board(s) until expiration of a period of one year after the nullification of the application or order. PERSON SUBMITTING DISCLOSURE: Print Name Javier E. Fernandez Signature / Sworn to and subscribed before me this Z.. `1" day of D(,--k` 0Y�. Z80 The foregoing instrument was acknowledged before me by 1 (,X \ i 41n °� who has produced as identification and/or is personally known to me and who (did/did not take an oath. STATE OF FLORIDA CITY OF MIAMIMY COMMISSION EXPIRES: KAREN S. ALVARADO MY COMMISSION # HH 443350 EXPIRES: October 9, 2027 Doc. No.:86543 Page 3 of 3 DISCLOSURE OF OWNERSHIP List the owner(s) of the subject property and percentage of ownership. Note: The Miami City Code requires all parties making any presentation, formal request or petition to the City Commission or any City board with respect to any real property to make full disclosure, in writing, of all parties having a financial interest, either direct or indirect, in the subject matter of said presentation, formal request or petition. Such disclosure shall include, but not be limited to, disclosure of all natural persons having an ownership interest, direct or indirect, in the subject real property. Accordingly, disclosure of shareholders of corporations, beneficiaries of trusts, and/or any other interested parties, together with their address(es) and proportionate interest are required. Please supply additional lists, if necessary. Owner's Name(s) AYME Properties, LLC Percentage of Ownership 100% Subject Property Address(es) 3101 Grand Ave (Folio No. 01-4121-030-0020 & 01-4121-030-0010) List all street address(es) and legal description(s) of any property located within 500 feet of the subject property owned by any and all parties listed in question #1 above. Please supply additional lists, if necessary. Street Address(es): None Legal Description(s): Tract A and B of HAAS Properties, according to the plat thereof, recorded in Plat Book 51, Page 65, of the Public Records of Miami -Dade County, Florida. Javier E. Fernandez Owner(s) or Attorney Name STATE OF FLORIDA -- COUNTY OF MIAMI-DADE The foregoing was acknowledged before me this `` day of DC4 D b (�X' 20 , by (,(,)� � > , 4 ( r)(I who is a(n) individual/partner/agent/corporation of a(n) individual/partnership/corporation. He/She is ® personally known to me or 0 who has produced as identification and who did 0 did not take an oath. Signature Rev. 10-18 KAREN S. ALVARADO MY COMMISSION # H4 443350 EXPIRES(2027 DISCLOSURE OF OWNERSHIP List the owner(s) of the subject property and percentage of ownership. Note: The Miami City Code requires all parties making any presentation, formal request or petition to the City Commission or any City board with respect to any real property to make full disclosure, in writing, of all parties having a financial interest, either direct or indirect, in the subject matter of said presentation, formal request or petition. Such disclosure shall include, but not be limited to, disclosure of all natural persons having an ownership interest, direct or indirect, in the subject real property. Accordingly, disclosure of shareholders of corporations, beneficiaries of trusts, and/or any other interested parties, together with their address(es) and proportionate interest are required. Please supply additional lists, if necessary. Owner's Name(s) AYME Florida Avenue Properties, LLC Percentage of Ownership 100% Subject Property Address(es) 3104, 3114, 3124, 3150, and 3158 Florida Avenue (Folio No. 01-4121-032-0120, 01-4121-032-0130, 01-4121-032-0140, 01-4121-032-0150, and 01-4121-032-0160). List all street address(es) and legal description(s) of any property located within 500 feet of the subject property owned by any and all parties listed in question #1 above. Please supply additional lists, if necessary. Street Address(es): None Legal Description(s): Lots 2, 3, 4, 5, & 6, Block 2, CHARLES H. FROW SUBDIVISION, according to the plat thereof, recorded in Plat Book 13, Page 53, of thePublic Records of Miami -Dade County, Florida. Javier E. Fernandez f Owner(s) or Attorney Name O€iner(s ttorney Signature STATE OF FLORIDA -- COUNTY OF MIAMI-DADE The foregoing was acknowledged before me this 22-T11 day of 0 (iQ h Y 20 r ,by /Ch,it) r - . I'r7�Y)(fr/ who is a(n) individual/partner/agent/corpojation of a(n) individual/partnership/corporation. He/She is0/personally known to me or 0 who has produced as identification and who D'idid 0 did not take an oath. KAREN S. ALVARADO MY COMMISSION # HH 443350 EXPIRES: Octtaern91.22127 001,11, Rev. 10-18 DISCLOSURE OF OWNERSHIP List the owner(s) of the subject property and percentage of ownership. Note: The Miami City Code requires all parties making any presentation, formal request or petition to the City Commission or any City board with respect to any real property to make full disclosure, in writing, of all parties having a financial interest, either direct or indirect, in the subject matter of said presentation, formal request or petition. Such disclosure shall include, but not be limited to, disclosure of all natural persons having an ownership interest, direct or indirect, in the subject real property. Accordingly, disclosure of shareholders of corporations, beneficiaries of trusts, and/or any other interested parties, together with their address(es) and proportionate interest are required. Please supply additional lists, if necessary. Owner's Name(s) 3100 Grove Trustee, LLC Percentage of Ownership 100% Subject Property Address(es) 3100 Florida Avenue (Folio No. 01-4121-032-0118) List all street address(es) and legal description(s) of any property located within 500 feet of the subject property owned by any and all parties listed in question #1 above. Please supply additional lists, if necessary. Street Address(es): None Legal Description(s): Lot 1, Block 2, CHARLES H. FROW SUBDIVISION, according to the plat thereof, recorded in Plat Book 13, Page 53, of thePublic Records of Miami -Dade County, Florida. Javier E. Fernandez Owner(s) or Attorney Name CvnerCsj_. ttorneyy Signature STATE OF FLORIDA -- COUNTY OF MIAMI-DADE The foregoing was acknowledged before me this f day of DC -I- a by 20 T , by „-''!\ t -i- ?. who is a(n) individual/partner/agent/corpor tion of a(n) individual/partnership/corporation. He/She is E7 personally known to me or 0 who has produced as identification and who I1did 0 did not take an oath. &Le. lOte-teatiadi) Signature KAREN S. ALVARADO MY COMMISSION # HH 443350 EXPIRES: Octot ,9tamp Rev. 10-18 State of Florida Department of State I certify from the records of this office that COCONUT GROVE CONDO, LLC is a Delaware limited liability company authorized to transact business in the State of Florida, qualified on December 4, 2024. The document number of this limited liability company is M24000015141. I further certify that said limited liability company has paid all fees due this office through December 31, 2025, that its most recent annual report was filed on April 20, 2025, and that its status is active. I further certify that said limited liability company has not filed a Certificate of Withdrawal. Given under my hand and the Great Seal of the State of Florida at Tallahassee, the Capital, this the Twenty-fourth day of October, 2025 Secretoty of tote Tracking Number: 2412026993CU To authenticate this certificate,visit the following site,enter this number, and then follow the instructions displayed. https://services.sunbiz.org/Filings/CertificateofStatus/CertificateAuthentication Prepared by: Javier E. Fernandez, Esq. Sanchez -Medina, Gonzalez, Lage, Gomez & Machado LLP 201 Alhambra Circle, Ste. 1205 Coral Gables, FL 33134 LIMITED POWER OF ATTORNEY KNOW ALL MEN BY THESE PRESENTanuel A. Espinosa as Authorized Representative of AYME Properties, LLC, does hereby appoint JAVIER E. FERNANDEZ, as the company's true and lawful attorney. In name, of the company, and for the company's use and benefit, JAVIER E. FERNANDEZ, is hereby authorized: To submit any and all such applications and forms required in connection with the processing of an application for the approval of a development agreement with the City of Miami, Florida, for the property described in Exhibit "A," attached hereto. Giving and granting to said attorney full power and authority to do all and every act and thing whatsoever requisite and necessary to be done on behalf of the company as fully and to all intents and purposes as the manager might or could do if personally present. All that said attorney shall lawfully do or cause to be done under the authority of this power of attorney is expressly approved. [REMAINDER OF PAGE LEFT INTENTIONALLY BLANK] [SIGNATURE AND NOTARIZATION APPEARS OF THE FOLLOWING PAGE] IN WITNESS WHEREOF, the individual described hereinabove sets his hand and seal this 10 }1 day of Sit .t kar174oS' , 2025. Signed, sealed and delivered In the presence of: WITNESS: Witness Signat re (`n ayoFC P int Name Witness Signature �rv�o�a�ca� Print Name STATE OF FLORIDA } } SS: COUNTY OF MIAMI-DADE f AYME PROPERTIES, LLC, a Florida limited liability company nt Name: Its: Authorized Representative The foregoing instrument was acknowledged before me by means of notarization, this jp'"' day of 074,( , 2025, by V R Representative, of AYME PROPERTIES, LLC, a Florida li ited lia known to me or has produced as ide icatio -Ian My Commission Expires: hysical presence or online as Authorized company. 1k is Ctrzonall did not take an oath. NET: ' ' ■ C, STATE OF FLORIDA 1-h Ida YA-maieb Print Name :A*dv'v . HILDA R. AMARO Notary Public - State of Florida iti `< Commission # HH 469310 "',for. My Comm. Expires Nov 30, 2027 ' Bonded through National Notary Assn, EXHIBIT "A" LEGAL DESCRIPTION OF PROPERTY Developer Name: Coconut Grove Condo, LLC Address: 3101 Grand Avenue, Miami, FL Folio No.: 01-4121-030-0020 Owner: AYME Properties, LLC Legal Description: Tract "B" of HAAS PROPERTIES, according to the Plat thereof, recorded in Plat Book 51, at Page 65 of the Public Records of Miami -Dade County, Florida. Address: 3101 Grand Avenue, Miami, FL Folio No.: 01-4121-030-0010 Owner: AYME Properties, LLC Legal Description: Tract "A" of HAAS PROPERTIES, according to the Plat thereof, recorded in Plat Book 51, at Page 65 of the Public Records of Miami -Dade County, Florida. Prepared by: Javier E. Fernandez, Esq. Sanchez -Medina, Gonzalez, Lage, Gomez & Machado LLP 201 Alhambra Circle, Ste. 1205 Coral Gables, FL 33134 LIMITED POWER OF ATTORNEY Manuel A. Espinosa KNOW ALL MEN BY THESE PRESENTS: , as Authorized Representative of AYME FLORIDA AVENUE PROPERTIES, LLC, does hereby appoint JAVIER E. FERNANDEZ, as the company's true and lawful attorney. In name, of the company, and for the company's use and benefit, JAVIER E. FERNANDEZ, is hereby authorized: To submit any and all such applications and forms required in connection with the processing of an application for the approval of a development agreement with the City of Miami, Florida, for the property described in Exhibit "A," attached hereto. Giving and granting to said attorney full power and authority to do all and every act and thing whatsoever requisite and necessary to be done on behalf of the company as fully and to all intents and purposes as the manager might or could do if personally present. All that said attorney shall lawfully do or cause to be done under the authority of this power of attorney is expressly approved. [REMAINDER OF PAGE LEFT INTENTIONALLY BLANK] [SIGNATURE AND NOTARIZATION APPEARS OF THE FOLLOWING PAGE] WITNESS WHEREOF, the individual described hereinabove sets his hand and seal this 1 4 day of ��k.f1„ b .(. r , 2025. Signed, sealed and delivered In the presence of: WITNESS: Witness Signature Armwxmda.`��, Print Name STATE OF FLORIDA } SS: COUNTY OF MIAMI-DADE } AYME FLORIDA AVENUE PROPERTIES, LLC, a Florida limited liability company By: Pr' t Na e: I s: Authorized Representative The foregoin instrument wa a knowledged before me by m ns of physical presence or online notarization, this t day of 19 1.n10).i.( , 2025, by kW A. g f al rtsh's Auth rized Representative, of AYME Florida Avenue Properties, LLC, a Florida limited liability company. is -town to me or has produced a . entification and did not take an My Commission Expires: •T • RY PUBLIC, STATE OF FLORIDA Print Name �— ."1641641— "vjf'•-, HILDA R. AMARO Notary Public - State of Florida Commission # HH 469310 11 ;? pr F° ' My Comm. Expires Nov 30, 2027 4 ' Bonded through National Notary Assn. EXHIBIT "A" LEGAL DESCRIPTION OF PROPERTY Developer Name: Coconut Grove Condo, LLC Address: 3104 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0120 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 2, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3114 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0130 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 3, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3124 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0140 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 4, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3150 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0150 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 5, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3158 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0160 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 6, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Prepared by: Javier E. Fernandez, Esq. Sanchez -Medina, Gonzalez, Lage, Gomez & Machado LLP 201 Alhambra Circle, Ste. 1205 Coral Gables, FL 33134 LIMITED POWER OF ATTORNEY KNOW ALL MEN BY THESE PRESENTS: Yazmin Gil, as Authorized Representative of 3101 GROVE TRUSTEE, LLC, does hereby appoint JAVIER E. FERNANDEZ, as the company's true and lawful attorney. In name, of the company, and for the company's use and benefit, JAVIER E. FERNANDEZ, is hereby authorized: To submit any and all such applications and forms required in connection with the processing of an application for the approval of a development agreement with the City of Miami, Florida, for the property described in Exhibit "A," attached hereto. Giving and granting to said attorney full power and authority to do all and every act and thing whatsoever requisite and necessary to be done on behalf of the company as fully and to all intents and purposes as the manager might or could do if personally present. All that said attorney shall lawfully do or cause to be done under the authority of this power of attorney is expressly approved. [REMAINDER OF PAGE LEFT INTENTIONALLY BLANK] [SIGNATURE AND NOTARIZATION APPEARS OF THE FOLLOWING PAGE] IN WITNESS WHEREOF, the individual described hereinabove sets his hand and seal this 10th day of September , 2025. Signed, sealed and delivered In the presence of: WITNESS: Witness Signatu re DaEIC CpaDFNtl Print Name Witness Signature �Gc\ Print Name STATE OF FLORIDA } SS: COUNTY OF M1AMI-DADE } 3101 GROVE TRUSTEE, LLC, a Delaware limited liability company By: PriF�� me: .ul►»TiLi L uthoriz d Representative The foregoing instrument was acknowledged before me by mns of physical presence or online notarization, this /0 day of ger,� , 2025, by ttiVIMV1 &li I , as Authorized Representative, of 3101 GROVE TRUSTEE, LLC, a Delaware limited liability company. He is personally known to me or has produced as identification and did not take an oath. My Commission Expires: �oaY Prig REVETAL ATTIAS ° \ (F:s Notary Public - State of Florida 1 $1 Commission # HH 605673 `•• ,oFn.° My Comm. Expires Oct 23, 2028 Bonded through National Notary Assn. 1TARY PUBLIC, STATE OF FLORIDA 1VA's Print Name EXHIBIT "A" LEGAL DESCRIPTION OF PROPERTY Address: 3100 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0118 Owner: 3101 Grove Trustee, LLC Developer Name: Coconut Grove Condo, LLC Legal Description: Lot 1, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. LESS the East five (5) feet and North five (5) feet of Lot 1, Block 2, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami - Dade County, Florida, as conveyed by Warranty Deed recorded in Deed Book 3791, Page 226, re -recorded in Official Records Book 5018, Page 116 of the Public Records of Miami -Dade County, Florida. Prepared by: Javier E. Fernandez, Esq. Sanchez -Medina, Gonzalez, Lage, Gomez & Machado LLP 201 Alhambra Circle, Ste. 1205 Coral Gables, FL 33134 LIMITED POWER OF ATTORNEY KNOW ALL MEN BY THESE PRESENTS: Yazmin Gil, as Manager of COCONUT GROVE CONDO, LLC, does hereby appoint JAVIER E. FERNANDEZ, as the company's true and lawful attorney. In name, of the company, and for the company's use and benefit, JAVIER E. FERNANDEZ, is hereby authorized: To submit any and all such applications and forms required in connection with the processing of a an application for the approval of a development agreement with the City of Miami, Florida, for the property described in Exhibit "A," attached hereto. Giving and granting to said attorney full power and authority to do all and every act and thing whatsoever requisite and necessary to be done on behalf of the company as fully and to all intents and purposes as the manager might or could do if personally present. All that said attorney shall lawfully do or cause to be done under the authority of this power of attorney is expressly approved. [REMAINDER OF PAGE LEFT INTENTIONALLY BLANK] [SIGNATURE AND NOTARIZATION APPEARS OF THE FOLLOWING PAGE] IN WITNESS WHEREOF, the individual described hereinabove sets his hand and seal this 10th day of September 2025. Signed, sealed and delivered In the presence of: WITNESS: k�1+R►�l,C.G 1, C2pd i;� Print Name Wlr Witness Signature g f&u4r, ?v vs 60" 640, Print Name 037,(41 STA I'L, OF FLORIDA } SS: COUNTY OF MIAMI-DADE COCONUT GROVE CONDO, LLC, a Delaware limited liability company By: Print N Its: M. ager The foregoing instrument was acknowledged before me by means of E physical presence or 0 online notarization, this ID day of StreeleibG - , 2025. by Yazm'n Cil anager, of Coconut Grove Condo, LLC, a Delaware limited liability company. She i personally known o me or has produced as identification and did not take an oa My Commission Expires: /0/2_3/ 02 y ..... REVETAL ATTIAS 1 'Fn Notary Pubic - State of Florida ` Commission # NH 605673 "' My Cornm. Expires Oct 23, 2028 Bonded through National Notary Assn. NOTARYf� PUBLIC, STATE OF FLORIDA -2_6V A5 Print Name Developer Name: Address: Folio No.: Legal Description: Address: Folio No.: Legal Description: Address: Folio No.: Legal Description: Address: Folio No.: Legal Description: EXHIBIT "A" LEGAL DESCRIPTION OF PROPERTY Coconut Grove Condo, LLC 3101 Grand Avenue, Miami, FL 01-4121-030-0020 Tract "B" of HAAS PROPERTIES, according to the Plat thereof, recorded in Plat Book 51, at Page 65 of the Public Records of Miami -Dade County, Florida. 3101 Grand Avenue, Miami, FL 01-4121-030-0010 Tract "A" of HAAS PROPERTIES, according to the Plat thereof, recorded in Plat Book 51, at Page 65 of the Public Records of Miami -Dade County, Florida. 3100 Florida Avenue, Miami, FL 01-4121-032-0118 Lot 1, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. LESS the East five (5) feet and North five (5) feet of Lot 1, Block 2, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami - Dade County, Florida, as conveyed by Warranty Deed recorded in Deed Book 3791, Page 226, re -recorded in Official Records Book 5018, Page 116 of the Public Records of Miami -Dade County, Florida. 3104 Florida Avenue, Miami, FL 01-4121-032-0120 Lot 2, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3114 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0130 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 3, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3124 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0140 Legal Description: Lot 4, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3150 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0150 Legal Description: Lot 5, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3158 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0160 Legal Description: Lot 6, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. DISCLOSURE AFFIDAVIT OF NO MONIES DUE TO THE CITY Cfit#g of Aliami 03-05-2021 In accordance with Section 2-208 of the Code of the City of Miami, Florida, as amended, ("City Code") titled, "New permits prohibited, non- homestead properties", permits shall not be issued for a non -homestead property with any outstanding code enforcement violations, building violations, or any relevant city lien or invoice due and owing to the City. Permits required to cure life safety issues, permits which are required to bring outstanding violations into compliance, or permits for any properties owned by a governmental entity are exempted from this prohibition. Each owner for each address listed as a party to the application needs to sign and submit this disclosure/affidavit. If an omission is the result of City of Miami oversight, then the City will notify the applicant and provide time for the applicant to resolve the issue within ninety (90) days. The project can be terminated by the City of Miami after the 90th day. Note: If you are a lessee on City of Miami -owned property, you must contact the Department of Real Estate and Asset Management to have this form completed by an authorized person. Name (title and name of entity as well, if applicable): Coconut Grove Condo, LLC Address/ City /state / Zip: 121 Alhambra Plaza, Ste. 1600, Coral Gables, FL 33134 Phone No: (305) 761-2274 Email: jfernandez@smgglaw.com 1, G✓1/ r. ,Yti hereby certify that all the addresses listed on this application are (please check one of the following): [ ] homestead properties. [ ] non -homestead properties, and that there are no open code enforcement violations, building violations, City liens, or invoices due and owing to the City on any of the addresses listed on this application. I certify that any City of Miami covenants on the properties are in full compliance and no associated monies due to the City. I certify there are no past due rent payments or associated interest due to the City for any of the addresses listed on this application. non -homestead properties that have open code enforcement violations, building violations, City liens, and/or invoices due and owing to the City. Please explain (required): 3101 and 3131 Grand Ave have open invoices which will be closed or paid prior to hearing, as applicable. I understand this application shall be terminated after ninety (90) days should any of the addresses listed on this application be found to not be in compliance with Section 2-208 of the City Code or with any covenant conditions attached to the land. ignature of t"r`operty Owner } State of Florida } County of Miami -Dade Date Sworn to and subscribed before me by means of L physical presence OR online notarization this day of 20 , by Ct , t: r -t t- t iVIT Personally known (1/or Produced Identification ( ) (a Type of Identification produced (SEAL) KAREN S. ALVARADO MY COMMISSION # HH 443350 EXPIRES: October 9, 2027 10/24/2025 Date CITY OF MIAMI HEARING BOARDS MIAMI RIVERSIDE CENTER 444 SW 2ND AVENUE, 3RD FLOOR MIAMI, FLORIDA 33130 RE: Property Owner's List Within 500 Feet of: Street Address(es) 3101 Grand Avenue, 3100 Florida Avenue, 3104 Florida Avenue, 3114 Florida Avenue, 3124 Florida Avenue 3150 Florida Avenue,3158 Florida Avenue Total number of labels without repetition: 198 I certify that the attached ownership list, map and mailing labels are a complete and accurate representation of the real estate property and property owners within a 500-foot radius of the subject property listed above. This information reflects the most current records on file in the Miami -Dade County Tax Assessor's Office. I also understand that a new list will be requested by the City of Miami Hearing Boards if it is determined the property owner information list initially submitted is older than six (6) months. Sincerely, ire-niatelf Signature Harley Mayoff Printed Name or Company Name 121 Alhambra Plaza #1600, Coral Gables, FL 33134 Address (305) 443-1000 Telephone hmayoff@allenmorris.com E-mail Rev. 10-18 FOLIO 0141210074470 0141210161010 0141210161070 0141210450010 0141210450040 0141210470070 0141210320200 0141210470180 0141210470200 0141210470240 0141210120010 0141210320110 0141210320180 0141211310090 0141211310370 0141210430040 0141210430060 0141210470020 0141210470050 0141210470400 0141210470480 0141211310050 0141211310061 0141213130001 0141213130010 0141213130060 0141213750001 0141211310290 0141211310010 0141210320009 0141210320070 0141210470010 0141210470040 0141210470060 0141210470190 0141210470340 0141210430091 0141210440011 0141213960020 0141210470390 0141210470420 0141210470430 0141213850001 0141213850010 0141213850020 0141210470460 0141213130020 0141213130050 0141211250010 0141211310001 0141211310080 0141211310240 0141211310310 TRUE_SITE_ADDR 3200 GRAND AVE 3351 MATILDA ST 3034 OAK AVE 3561 MAIN HWY 3471 MAIN HWY 3166 COMMODORE PLZ 3190 FLORIDA AVE 3102 COMMODORE PLZ 3468 MAIN HWY 3112 COMMODORE PLZ 3201 THOMAS AVE 3155 FLORIDA AVE 3170 FLORIDAAVE 3162 COMMODORE PLZ 11 3162 COMMODORE PLZ 3F 3425 MAIN HWY 3419 MAIN HWY 3190 COMMODORE PLZ 3176 COMMODORE PLZ 3155 COMMODORE PLZ 3456 MAIN HWY 3162 COMMODORE PLZ 3162 COMMODORE PLZ 3160 OAK AVE 3160 3182 OAK AVE 3182 3175 FLORIDAAVE 3162 COMMODORE PLZ 2F 3162 COMMODORE PLZ 1A 3120 OAK AVE 3197 FLORIDAAVE 3194 COMMODORE PLZ 3180 COMMODORE PLZ 3170 COMMODORE PLZ 3100 COMMODORE PLZ 3197 COMMODORE PLZ 3401 MAIN HWY 3418 MAIN HWY 3172 OAK AVE 3172 3157 COMMODORE PLZ 3141 COMMODORE PLZ 3133 COMMODORE PLZ 3171 FLORIDA AVE 3171 3173 FLORIDAAVE 3173 3105 COMMODORE PLZ 3162 OAK AVE 3162 3180 OAK AVE 3180 3444 MAIN HWY 3162 COMMODORE PLZ 1H 3162 COMMODORE PLZ 2A 3162 COMMODORE PLZ 2H TRUE_SITE_UNIT TRUE_SITE_CITY TRUE_SITE_ZIP_CODE Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 11 Miami 33133-0000 3F Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 1E 1E Miami 33133-0000 1F2 1F2 Miami 33133-0000 Miami 33133-0000 3160 Miami 33133-0000 3182 Miami 33133-0000 Miami 33133-0000 2F Miami 33133-0000 1A Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 3172 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 3171 Miami 33133-0000 3173 Miami 33133-0000 Miami 33133-0000 3162 Miami 33133-0000 3180 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 1H Miami 33133-0000 2A Miami 33133-0000 2H Miami 33133-0000 0141211310330 0141211310401 0141213750010 0141213750020 0141213960001 0141210320010 0141210320080 0141210320170 0141211260010 0141210430031 0141210430070 0141211310020 0141211310040 0141211310060 0141210440010 0141210440030 0141210470120 0141211310070 0141211310250 0141211310300 0141210470130 0141210470210 0141210470410 0141210470440 0141210470470 0141210161090 0141213130040 0141213130030 0141213960010 3162 COMMODORE PLZ 3B 3162 COMMODORE PLZ 4A 3175 FLORIDAAVE 3175 3177 FLORIDA AVE 3177 3152 OAK AVE 3189 FLORIDAAVE 3160 FLORIDAAVE 3015 GRAND AVE 3435 MAIN HWY 3423 MAIN HWY 3162 COMMODORE PLZ 3162 COMMODORE PLZ 3162 COMMODORE PLZ 3406 MAIN HWY 3432 MAIN HWY 3120 COMMODORE PLZ 3162 COMMODORE PLZ 3162 COMMODORE PLZ 2B 3162 COMMODORE PLZ 2G 3138 COMMODORE PLZ 3480 MAIN HWY 3145 COMMODORE PLZ 3131 COMMODORE PLZ 3462 MAIN HWY 3067 GRAND AVE 3168 OAK AVE 3168 3166 OAK AVE 3166 3170 OAK AVE 3170 1B 1D 1F1 3B 4A 3175 3177 1B 1D 1F1 1G 1G 2B 2G 3168 3166 3170 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 TRUE_OWNER1 MICHAEL E MARMESH &W NANCY S BOARD OF PUBLIC INSTRUCTION ARBOR GROVE DEVELOPMENT LLC ST STEPHENS PROP EPISCOPAL CH CLOISTERS ON THE BAY CONDO DHARMA STUDIO INC US POSTAL SERVICE 3100 COMMODORE LLC 3468 MAIN HWY LLC 3112 COMMODORE PLAZA INVEST LLC JORGE L MORALES STEVEN R CAPELLINI TRS HABITUS FLORIDA AVENUE LLC URBIN COMMODORE PREMIUM SPACE HOLDINGS LLC MAIN HIGHWAY LLCTRS MAIN HIGHWAY 3419 LLC 3190 COMMODORE LLC MAA REAL ESTATE LLC PLYMOUTH CONGREGATIONAL CHURCH CHRISTIAN SCIENCE SOCIETY OF SIVEL PROPERTIES LLC 3162 COMMODORE LLC REFERENCE ONLY SEHER SAMILGIL LUIS J MORENO REFERENCE ONLY PATRICK GARELLE INTL CORP 3162 GROVE LLC CITY OF MIAMI PATRICIA C JOHNSON COMMODORE GRAND LLC AVENUE GROUPER ART GALLERY LLC URBIN COMMODORE 3100 COMMODORE LLC COMMODORE CORNER LLC MAIN HIGHWAY LLCTRS TOM TOWLE JR TRS DEBORAH LAURIA COMMODORE 3157 LLC SERGE RENARD COMMODORE PLAZA LLC REFERENCE ONLY INAGUA HOLDINGS INC JAVIER CUADRA 3121 COMMODORE CORP SCOTTJAMES BUTLER RODRIGO A OLIVARES LE 3140 GRAND LLC REFERENCE ONLY GROUPER COMMODORE 3162 LLC 3162 GROVE LLC ERIC S COPELAND &W CLAUDIA M TRUE_OWNER2 ASSN INC FEDERAL REALTY INVESTMENTTR THE CAPELLINI LIVING TRUST RESIDENTIAL SPE LLC MAIN HIGHWAY LAND TRUST COCONUT GROVE MIAMI FLORIDA INC CENKHAN SAMILGIL JUSTIN M JOHNSON RESIDENTIAL II SPE LLC MAIN HIGHWAY LAND TRUST ELISA CUADRA ELIZABETH JANE MANDERS BLANCA A OLIVARES LE C/O POINTE GROUP ADVISORS URBIN COMMODORE URBIN COMMODORE RESIDENTIAL PHILIPPE AMOUYAL MONICA CUELLAR TOBON REFERENCE ONLY CITY OF MIAMI ARLENE L MCCREARY TRS CASTANHA X LLC FRIT COCOWALK OWNER LLC COCONUT BUILDING INC MAIN HIGHWAY 2 LLC 3162 GROVE LLC SIVEL PROPERTIES LLC 3162 COMMODORE LLC 3406 MAIN HIGHWAY LLC COGO LTD TB 3120 COMMODORE INVESTMENTS LLC GROUPER COMMODORE 3162 LLC 3162 GROVE LLC THOMAS DEAN KENNEDY URBIN COMMODORE SPE LLC(LEASEE) 3480 MAIN HIGHWAY LLC RUTH W & JOSEPH L FALK & 3131 COMMODORE PLAZA 3462 MAIN HIGHWAY LLC JAGUAR GROVE PROPERTY INC JULIO C MATA DANETTE ANDERSON TRS CRISTIAN DEL RIO RESIDENTIAL SPE LLC SPE LLC ROBIN AMOUYAL ARLENE L MCCREARY TRUST C/O STEPHEN H SMITH C/O FEDERAL REALTY INVESTMENTTR FEDERAL REALTY INVESTMENTTR TB 3138 COMMODORE INVESTMENTS LLC JUDITH S RICHARD FEDERAL REALTY INVESTMENTTR MARIA C MATA DANETTE ANDERSON REVOCABLE TR VIVIANNE DEL RIO MAILING_BLOCK_LINE1 MAILING_BLOCK_LINE2 MICHAEL E MARMESH &W NANCY S BOARD OF PUBLIC INSTRUCTION ARBOR GROVE DEVELOPMENT LLC ST STEPHENS PROP EPISCOPAL CH CLOISTERS ON THE BAY CONDO ASSN INC DHARMA STUDIO INC US POSTAL SERVICE 3100 COMMODORE LLC 3468 MAIN HWY LLC 3112 COMMODORE PLAZA INVEST LLC % FEDERAL REALTY INVESTMENTTR JORGE L MORALES STEVEN R CAPELLINI TRS THE CAPELLINI LIVING TRUST HABITUS FLORIDA AVENUE LLC URBIN COMMODORE RESIDENTIAL SPE LLC PREMIUM SPACE HOLDINGS LLC MAIN HIGHWAY LLC TRS MAIN HIGHWAY LAND TRUST MAIN HIGHWAY 3419 LLC 3190 COMMODORE LLC MAA REAL ESTATE LLC PLYMOUTH CONGREGATIONAL CHURCH CHRISTIAN SCIENCE SOCIETY OF COCONUT GROVE MIAMI FLORIDA INC SIVEL PROPERTIES LLC 3162 COMMODORE LLC REFERENCE ONLY SEHER SAMILGIL CENKHAN SAMILGIL LUIS J MORENO REFERENCE ONLY PATRICK GARELLE INTL CORP 3162 GROVE LLC CITY OF MIAMI PATRICIA C JOHNSON JUSTIN M JOHNSON COMMODORE GRAND LLC AVENUE GROUPER ART GALLERY LLC URBIN COMMODORE RESIDENTIAL II SPE LLC 3100 COMMODORE LLC COMMODORE CORNER LLC MAIN HIGHWAY LLC TRS MAIN HIGHWAY LAND TRUST TOM TOWLE JR TRS DEBORAH LAURIA COMMODORE 3157 LLC SERGE RENARD COMMODORE PLAZA LLC REFERENCE ONLY INAGUA HOLDINGS INC JAVIER CUADRA ELISA CUADRA 3121 COMMODORE CORP SCOTTJAMES BUTLER ELIZABETH JANE MANDERS RODRIGO A OLIVARES LE BLANCA A OLIVARES LE 3140 GRAND LLC C/O POINTE GROUP ADVISORS REFERENCE ONLY GROUPER COMMODORE 3162 LLC 3162 GROVE LLC ERIC S COPELAND &W CLAUDIA M URBIN COMMODORE URBIN COMMODORE RESIDENTIAL PHILIPPE AMOUYAL MONICA CUELLAR TOBON REFERENCE ONLY CITY OF MIAMI ARLENE L MCCREARY TRS CASTANHA X LLC FRIT COCOWALK OWNER LLC COCONUT BUILDING INC MAIN HIGHWAY 2 LLC 3162 GROVE LLC SIVEL PROPERTIES LLC 3162 COMMODORE LLC 3406 MAIN HIGHWAY LLC COGO LTD TB 3120 COMMODORE INVESTMENTS LLC GROUPER COMMODORE 3162 LLC 3162 GROVE LLC THOMAS DEAN KENNEDY URBIN COMMODORE SPE LLC(LEASEE) 3480 MAIN HIGHWAY LLC RUTH W & JOSEPH L FALK & 3131 COMMODORE PLAZA 3462 MAIN HIGHWAY LLC JAGUAR GROVE PROPERTY INC JULIO C MATA DANETTE ANDERSON TRS CRISTIAN DEL RIO RESIDENTIAL SPE LLC SPE LLC ROBIN AMOUYAL ARLENE L MCCREARY TRUST C/O STEPHEN H SMITH C/O FEDERAL REALTY INVESTMENTTR FEDERAL REALTY INVESTMENTTR TB 3138 COMMODORE INVESTMENTS LLC JUDITH S RICHARD FEDERAL REALTY INVESTMENTTR MARIA C MATA DANETTE ANDERSON REVOCABLE TR VIVIANNE DEL RIO MAI LI NG_BLOCK_LI N E3 3200 GRAND AVE 1410 NE 2 AVE 1000 N HIATUS RD #103 3439 MAIN HWY 3471 MAIN HWY 1867 TIGERTAIL AVE 225 NO HUMPHREYS BLVD 3350 MARY ST PO BOX 330196 909 ROSE AVENUE SUITE 200 PO BOX 330024 3155 FLORIDA AVE 3350 VIRGINIA ST 2525 PONCE DE LEON BLVD FL 9 9755 SW 40 TER 2900 OAK AVE 2900 OAI< AVE 20900 NE 30 AVE STE 600 1050 NE 86 ST 3429 DEVON RD 3840 MAIN HWY 3444 MAIN HGWY # 9 344 MAIN HWY 2 FLOOR 3160 OAK AVE 3182 OAI< AVE UNIT 3182 3162 COMMODORE PLAZA 2F 3444 MAIN HIGHWAY 2 FLOOR 444 SW 2ND AVE 3RD FLOOR 3197 FLORIDA AVE 3155 FLORIDA AVE 2980 MCFARLANE RD 299 ALHAMBRA CIR STE 510 3350 MARY ST PO BOX 33-1850 2900 OAK AVE 1800 PURDY AVE #714 3172 OAK AVE 3172 PO BOX 431436 3141 COMMODORE PLZ 14342 76 ST 620 HARBOR CIR 3173 FLORIDA AVE 3121 COMMODORE PLAZE 3162 OAK AVE 3180 OAK AVE 13218 W BROWARD BLVD 2980 MCFARLANE RD 12 3444 MAIN HIGHWAY 2 FLOOR 737 CAMILO AVE MAI LI NG_BLOCK_LI N E4 MIAMI, FL 33133-5011 MIAMI, FL 33132-1308 PEMBROKE PINES, FL 33026 MIAMI, FL 33133-5915 MIAMI, FL 33133 MIAMI, FL 33133 MEMPHIS, TN 38166 MIAMI, FL 33133 MIAMI, FL 33233-0196 NORTH BETHESDA, MD 20852 MIAMI, FL 33233-0024 MIAMI, FL 33133 COCONUT GROVE, FL 33133 CORAL GABLES, FL 33134-6039 MIAMI, FL 33165 MIAMI, FL 33133 MIAMI, FL 33133 AVENTURA, FL 33180 MIAMI, FL 33138 COCONUT GROVE, FL 33133-6201 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33130-1910 MIAMI, FL 33173 COCONUT GROVE, FL 33133 MIAMI, FL 33133 CORAL GABLES, FL 33134 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI BEACH, FL 33139 COCONUT GROVE, FL 33133 MIAMI, FL 33243 MIAMI, FL 33133-5817 LIVE OAK, FL 32060 KEY BISCAYNE, FL 33149 MIAMI, FL 33133 MIAMI, FL 33133-5846 MIAMI, FL 33133 MIAMI, FL 33133 PLANTATION, FL 33325 MIAMI, FL 33133 MIAMI, FL 33133 CORAL GABLES, FL 33134-7007 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 3175 FLORIDA AVE 3175 3177 FLORIDA AVE # 3177 444 SW 2ND AVE 3RD FLOOR 3189 FLORIDA AVE 4277 INGRAHAM HWY 909 ROSE AVENUE SUITE 200 8600 NW 17 ST STE 110 2900 OAI< AVE 3444 MAIN HIGHWAY 2 FLOOR 3444 MAIN HGWY # 9 344 MAIN HWY 2 FLOOR 909 ROSE AVENUE SUITE 200 PO BOX 331330 2665 BAYSHORE DR STE 1020 2980 MCFARLANE RD 12 3444 MAIN HIGHWAY 2 FLOOR 3162 COMMODORE PLAZA #2 G 2665 SO BAYSHORE DR STE 1101 2601 S BAYSHORE DR 1450 1770 MICANOPY AVE 909 ROSE AVENUE SUITE 200 PO BOX 33-1850 2811 EMATHIA ST 3168 OAI< AVE 3166 OAK AVE 3166 3170 OAK AVE CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 COCONUT GROVE, FL 33133 MIAMI, FL 33133 MIAMI, FL 33130-1910 COCONUT GROVE, FL 33133 MIAMI, FL 33133 NORTH BETHESDA, MD 20852 DORAL, FL 33126 COCONUT GROVE, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 NORTH BETHESDA, MD 20852 MIAMI, FL 33233-1330 COCONUT GROVE, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 COCONUT GROVE, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133-3323 NORTH BETHESDA, MD 20852 MIAMI, FL 33133 MIAMI, FL 33133-3246 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 FOLIO TRUE_SITE_ADDR TRUE_SITE_UNIT TRUE_SITE_CITY TRUE_SITE_ZIP_CODE 0141210090031 3201 FLORIDA AVE Miami 33133-0000 0141210120010 3201 THOMAS AVE Miami 33133-0000 0141210120020 3211 THOMAS AVE Miami 33133-0000 0141210320120 3104 FLORIDA AVE Miami 33133-0000 0141210320130 3114 FLORIDA AVE Miami 33133-0000 0141210450010 3561 MAIN HWY Miami 33133-0000 0141210300010 3131 GRAND AVE Miami 33133-0000 0141210320110 3155 FLORIDA AVE Miami 33133-0000 0141210320118 3100 FLORIDA AVE Miami 33133-0000 0141210320180 3170 FLORIDA AVE Miami 33133-0000 0141210320240 3143 GRAND AVE Miami 33133-0000 0141210161010 3351 MATILDA ST Miami 33133-0000 0141211310090 3162 COMMODORE PLZ 11 11 Miami 33133-0000 0141211310370 3162 COMMODORE PLZ 3F 3F Miami 33133-0000 0141211310402 3162 COMMODORE PLZ 4B 4B Miami 33133-0000 0141211310411 3162 COMMODORE PLZ 4E 4E Miami 33133-0000 0141211310413 3162 COMMODORE PLZ 4G 4G Miami 33133-0000 0141211310050 3162 COMMODORE PLZ 1E 1E Miami 33133-0000 0141211310061 3162 COMMODORE PLZ 1F2 1F2 Miami 33133-0000 0141211310100 3162 COMMODORE PLZ 1J 1J Miami 33133-0000 0141210430040 3425 MAIN HWY Miami 33133-0000 0141210430060 3419 MAIN HWY Miami 33133-0000 0141210470020 3190 COMMODORE PLZ Miami 33133-0000 0141210470050 3176 COMMODORE PLZ Miami 33133-0000 0141210470230 3106 COMMODORE PLZ Miami 33133-0000 0141210470400 3155 COMMODORE PLZ Miami 33133-0000 0141211310414 3162 COMMODORE PLZ 4H 4H Miami 33133-0000 0141211310440 3162 COMMODORE PLZ 6A 6A Miami 33133-0000 0141211310490 3162 COMMODORE PLZ 6E 6E Miami 33133-0000 0141211310010 3162 COMMODORE PLZ 1A 1A Miami 33133-0000 0141211310030 3162 COMMODORE PLZ 1C 1C Miami 33133-0000 0141213130001 Miami 33133-0000 0141213130010 3160 OAK AVE 3160 3160 Miami 33133-0000 0141213130060 3182 OAK AVE 3182 3182 Miami 33133-0000 0141210460010 3461 MAIN HWY Miami 33133-0000 0141210120442 3200 THOMAS AVE Miami 33133-0000 0141210320009 3120 OAK AVE Miami 33133-0000 0141210320060 3301 MCDONALD ST Miami 33133-0000 0141211310110 3162 COMMODORE PLZ 1K 1K Miami 33133-0000 0141211310290 3162 COMMODORE PLZ 2F 2F Miami 33133-0000 0141211310320 3162 COMMODORE PLZ 3A 3A Miami 33133-0000 0141210470480 3456 MAIN HWY Miami 33133-0000 0141213750001 3175 FLORIDA AVE Miami 33133-0000 0141213850001 Miami 33133-0000 0141210470010 3194 COMMODORE PLZ Miami 33133-0000 0141210470040 3180 COMMODORE PLZ Miami 33133-0000 0141210470060 3170 COMMODORE PLZ Miami 33133-0000 0141210320070 3197 FLORIDA AVE Miami 33133-0000 0141210320150 3150 FLORIDA AVE Miami 33133-0000 0141210320190 3174 FLORIDA AVE Miami 33133-0000 0141211310340 3162 COMMODORE PLZ 3C 3C Miami 33133-0000 0141211310350 3162 COMMODORE PLZ 3D 3D Miami 33133-0000 0141211310360 3162 COMMODORE PLZ 3E 3E Miami 33133-0000 0141210470190 0141210470340 0141210470390 0141210320210 0141210320230 0141210430030 0141210470420 0141210470430 0141210470460 0141210430091 0141210440011 0141213960020 0141213130020 0141213130050 0141211250010 0141211310001 0141211310080 0141211310240 0141211310310 0141211310330 0141211310423 0141211310380 0141211310390 0141211310401 0141211310403 0141211310404 0141211310421 0141211310422 0141211310431 0141211310432 0141211310460 0141211310500 0141211310510 0141211310470 0141211950014 0141213130030 0141213750010 0141213750020 0141213870020 0141213850010 0141213850020 0141210161090 0141213960001 0141210300020 0141210320010 0141210320080 0141210320140 0141210320160 0141210320170 0141210320220 0141210430031 0141210430070 0141210440010 0141210440030 3100 COMMODORE PLZ 3197 COMMODORE PLZ 3157 COMMODORE PLZ 3192 FLORIDA AVE 3195 GRAND AVE 2750 MC FARLANE RD 3141 COMMODORE PLZ 3133 COMMODORE PLZ 3105 COMMODORE PLZ 3401 MAIN HWY 3418 MAIN HWY 3172 OAK AVE 3172 3162 OAK AVE 3162 3180 OAK AVE 3180 3444 MAIN HWY 3162 COMMODORE PLZ 1H 3162 COMMODORE PLZ 2A 3162 COMMODORE PLZ 2H 3162 COMMODORE PLZ 3B 3162 COMMODORE PLZ 5C 3162 COMMODORE PLZ 3G 3162 COMMODORE PLZ 3H 3162 COMMODORE PLZ 4A 3162 COMMODORE PLZ 4C 3162 COMMODORE PLZ 4D 3162 COMMODORE PLZ 5A 3162 COMMODORE PLZ 5B 3162 COMMODORE PLZ 5D 3162 COMMODORE PLZ 5E 3162 COMMODORE PLZ 6B 3162 COMMODORE PLZ 6F 3162 COMMODORE PLZ 6H 3162 COMMODORE PLZ 6C 3220 FLORIDA AVE 3166 OAK AVE 3166 3175 FLORIDA AVE 3175 3177 FLORIDA AVE 3177 3192 OAK AVE 3192 3171 FLORIDA AVE 3171 3173 FLORIDA AVE 3173 3067 GRAND AVE 3101 GRAND AVE 3152 OAK AVE 3189 FLORIDA AVE 3124 FLORIDA AVE 3158 FLORIDA AVE 3160 FLORIDA AVE 3365 SW 32 AVE 3435 MAIN HWY 3423 MAIN HWY 3406 MAIN HWY 3432 MAIN HWY Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 3172 Miami 33133-0000 3162 Miami 33133-0000 3180 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 1H Miami 33133-0000 2A Miami 33133-0000 2H Miami 33133-0000 3B Miami 33133-0000 5C Miami 33133-0000 3G Miami 33133-0000 3H Miami 33133-0000 4A Miami 33133-0000 4C Miami 33133-0000 4D Miami 33133-0000 5A Miami 33133-0000 5B Miami 33133-0000 5D Miami 33133-0000 5E Miami 33133-0000 6B Miami 33133-0000 6F Miami 33133-0000 6H Miami 33133-0000 6C Miami 33133-0000 Miami 33133-0000 3166 Miami 33133-0000 3175 Miami 33133-0000 3177 Miami 33133-0000 3192 Miami 33133-0000 3171 Miami 33133-0000 3173 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 0141210470120 0141210470130 0141210470210 0141211260010 0141211310020 0141211310040 0141210074480 0141210120030 0141213870001 0141211310060 0141211310070 0141211310250 0141211310260 0141211310270 0141211310300 0141211310412 0141211310433 0141211310480 0141210470410 0141210470440 0141210470470 0141211950010 0141213130040 0141213870010 0141213960010 3120 COMMODORE PLZ 3138 COMMODORE PLZ 3480 MAIN HWY 3015 GRAND AVE 3162 COMMODORE PLZ 1B 1B 3162 COMMODORE PLZ 1D 1D 3206 GRAND AVE 3221 THOMAS AVE 3162 COMMODORE 3162 COMMODORE 3162 COMMODORE 3162 COMMODORE 3162 COMMODORE 3162 COMMODORE 3162 COMMODORE 3162 COMMODORE 3162 COMMODORE 3145 COMMODORE 3131 COMMODORE 3462 MAIN HWY 3211 GRAND AVE 3168 OAK AVE 3168 3190 OAK AVE 3190 3170 OAK AVE 3170 PLZ 1F1 1F1 PLZ 1G 1G PLZ 2B 2B PLZ 2C 2C PLZ 2D 2D PLZ 2G 2G PLZ 4F 4F PLZ 5F 5F PLZ 6D 6D PLZ PLZ 3168 3190 3170 Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 TRUE_OWNER1 JESSIE HARVIN JR JORGE L MORALES SCOTT CHORMANSKI AYME FLORIDAAVENUE PROPERTIES AYME FLORIDAAVENUE ST STEPHENS PROP EPISCOPAL CH AYME PROPERTIES LLC STEVEN R CAPELLINI TRS 3101 GROVE TRUSTEE LLC TRS HABITUS FLORIDAAVENUE LLC US POSTAL SVC BOARD OF PUBLIC INSTRUCTION URBIN COMMODORE PREMIUM SPACE HOLDINGS LLC URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL SIVEL PROPERTIES LLC 3162 COMMODORE LLC URBIN COMMODORE MAIN HIGHWAY LLC TRS MAIN HIGHWAY 3419 LLC 3190 COMMODORE LLC MAA REAL ESTATE LLC 3100 COMMODORE LLC PLYMOUTH CONGREGATIONAL CHURCH URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL 3162 GROVE LLC URBIN COMMODORE REFERENCE ONLY SEHER SAMILGIL LUIS J MORENO ST STEPHENS PROT EPIS CHURCH FIORI ONE INVESTMENTS LLC CITY OF MIAMI 3301 MCDONALD STREET LLC URBIN COMMODORE PATRICK GARELLE INTL CORP URBIN COMMODORE CHRISTIAN SCIENCE SOCIETY OF REFERENCE ONLY REFERENCE ONLY COMMODORE GRAND LLC AVENUE GROUPER ART GALLERY LLC URBIN COMMODORE PATRICIA C JOHNSON AYME FLORIDA AVE PROPERTIES LLC US POSTAL SERVICE URBIN COMMODORE URBIN COMMODORE PREMIUM SPACE HOLDINGS LLC TRUE_OWNER2 VIRGINIA HARVIN THERESAANN CHORMANSKI LLC PROPERTIES LLC THE CAPELLINI LIVING TRUST 3101 GROVE LAND TRUST RESIDENTIAL SPE LLC SPE LLC SPE LLC SPE LLC RESIDENTIAL SPE LLC MAIN HIGHWAY LAND TRUST SPE LLC SPE LLC SPE LLC RESIDENTIAL SPE LLC CENKHAN SAMILGIL RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC COCONUT GROVE MIAMI FLORIDA INC RESIDENTIAL II SPE LLC JUSTIN M JOHNSON RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC 3100 COMMODORE LLC COMMODORE CORNER LLC COMMODORE 3157 LLC US POSTAL SERVICE U S POSTAL SERVICE ST STEPHENS EPIS CHURCH SERGE RENARD COMMODORE PLAZA LLC 3121 COMMODORE CORP MAIN HIGHWAY LLC TRS TOM TOWLE JR TRS DEBORAH LAURIA SCOTTJAMES BUTLER RODRIGO A OLIVARES LE 3140 GRAND LLC REFERENCE ONLY GROUPER COMMODORE 3162 LLC 3162 GROVE LLC ERIC S COPELAND &W CLAUDIA M URBIN COMMODORE URBIN COMMODORE RESIDENTIAL PREMIUM SPACE HOLDINGS LLC PREMIUM SPACE HOLDINGS LLC URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL LUIS GABRIEL CINTRON TRS DANETTE ANDERSON TRS PHILIPPE AMOUYAL MONICA CUELLAR TOBON BRIAN LEVIN INAGUA HOLDINGS INC JAVIER CUADRA JAGUAR GROVE PROPERTY INC REFERENCE ONLY AYME PROPERTIES LLC CITY OF MIAMI ARLENE L MCCREARY TRS AYME FLORIDAAVENUE AYME FLORIDAAVENUE CASTANHA X LLC U S POSTAL SERVICE COCONUT BUILDING INC MAIN HIGHWAY 2 LLC 3406 MAIN HIGHWAY LLC COGO LTD MAIN HIGHWAY LAND TRUST ELIZABETH JANE MANDERS BLANCA A OLIVARES LE C/O POINTE GROUP ADVISORS RESIDENTIAL SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC RESIDENTIAL SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC CINTRON RESIDENTIAL REV TR DANETTE ANDERSON REVOCABLE TR ROBIN AMOUYAL REBECA YALE LEVIN ELISA CUADRA ARLENE L MCCREARY TRUST PROPERTIES LLC PROPERTIES LLC C/O STEPHEN H SMITH % FEDERAL REALTY INVESTMENT TR TB 3120 COMMODORE INVESTMENTS LLC URBIN COMMODORE SPE LLC(LEASEE) 3480 MAIN HIGHWAY LLC FRIT COCOWALK OWNER LLC 3162 GROVE LLC SIVEL PROPERTIES LLC 3206 GRAND AVENUE LLC VIRGINIA ARDELL STIRRUP REFERENCE ONLY 3162 COMMODORE LLC GROUPER COMMODORE 3162 LLC 3162 GROVE LLC 3162 GROVE LLC 3162 GROVE LLC THOMAS DEAN I<ENNEDY URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL RUTH W & JOSEPH L FALK & 3131 COMMODORE PLAZA 3462 MAIN HIGHWAY LLC GRAND AVENUE PLAZA LLC JULIO C MATA GREGORY DEUTCH CRISTIAN DEL RIO TB 3138 COMMODORE INVESTMENTS LLC C/O FEDERAL REALTY INVESTMENTTR % FEDERAL REALTY INVESTMENTTR SPE LLC SPE LLC SPE LLC JUDITH S RICHARD % FEDERAL REALTY INVESTMENTTR MARIA C MATA LAUREN DEUTCH VIVIANNE DEL RIO MAILING_BLOCK_LINE1 JESSIE HARVIN JR JORGE L MORALES SCOTT CHORMANSKI AYME FLORIDAAVENUE PROPERTIES AYME FLORIDAAVENUE ST STEPHENS PROP EPISCOPAL CH AYME PROPERTIES LLC STEVEN R CAPELLINI TRS 3101 GROVE TRUSTEE LLC TRS HABITUS FLORIDAAVENUE LLC US POSTAL SVC BOARD OF PUBLIC INSTRUCTION URBIN COMMODORE PREMIUM SPACE HOLDINGS LLC URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL SIVEL PROPERTIES LLC 3162 COMMODORE LLC URBIN COMMODORE MAIN HIGHWAY LLC TRS MAIN HIGHWAY 3419 LLC 3190 COMMODORE LLC MAA REAL ESTATE LLC 3100 COMMODORE LLC PLYMOUTH CONGREGATIONAL CHURCH URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL 3162 GROVE LLC URBIN COMMODORE REFERENCE ONLY SEHER SAMILGIL LUIS J MORENO ST STEPHENS PROT EPIS CHURCH FIORI ONE INVESTMENTS LLC CITY OF MIAMI 3301 MCDONALD STREET LLC URBIN COMMODORE PATRICK GARELLE INTL CORP URBIN COMMODORE CHRISTIAN SCIENCE SOCIETY OF REFERENCE ONLY REFERENCE ONLY COMMODORE GRAND LLC AVENUE GROUPER ART GALLERY LLC URBIN COMMODORE PATRICIA C JOHNSON AYME FLORIDA AVE PROPERTIES LLC US POSTAL SERVICE URBIN COMMODORE URBIN COMMODORE PREMIUM SPACE HOLDINGS LLC MAI LI NG_BLOCK_LI N E2 VIRGINIA HARVIN THERESAANN CHORMANSKI LLC PROPERTIES LLC THE CAPELLINI LIVING TRUST 3101 GROVE LAND TRUST RESIDENTIAL SPE LLC SPE LLC SPE LLC SPE LLC RESIDENTIAL SPE LLC MAIN HIGHWAY LAND TRUST SPE LLC SPE LLC SPE LLC RESIDENTIAL SPE LLC CENKHAN SAMILGIL RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC COCONUT GROVE MIAMI FLORIDA INC RESIDENTIAL II SPE LLC JUSTIN M JOHNSON RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC 3100 COMMODORE LLC COMMODORE CORNER LLC COMMODORE 3157 LLC US POSTAL SERVICE U S POSTAL SERVICE ST STEPHENS EPIS CHURCH SERGE RENARD COMMODORE PLAZA LLC 3121 COMMODORE CORP MAIN HIGHWAY LLC TRS TOM TOWLE JR TRS DEBORAH LAURIA SCOTTJAMES BUTLER RODRIGO A OLIVARES LE 3140 GRAND LLC REFERENCE ONLY GROUPER COMMODORE 3162 LLC 3162 GROVE LLC ERIC S COPELAND &W CLAUDIA M URBIN COMMODORE URBIN COMMODORE RESIDENTIAL PREMIUM SPACE HOLDINGS LLC PREMIUM SPACE HOLDINGS LLC URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL LUIS GABRIEL CINTRON TRS DANETTE ANDERSON TRS PHILIPPE AMOUYAL MONICA CUELLAR TOBON BRIAN LEVIN INAGUA HOLDINGS INC JAVIER CUADRA JAGUAR GROVE PROPERTY INC REFERENCE ONLY AYME PROPERTIES LLC CITY OF MIAMI ARLENE L MCCREARY TRS AYME FLORIDAAVENUE AYME FLORIDAAVENUE CASTANHA X LLC U S POSTAL SERVICE COCONUT BUILDING INC MAIN HIGHWAY 2 LLC 3406 MAIN HIGHWAY LLC COGO LTD MAIN HIGHWAY LAND TRUST ELIZABETH JANE MANDERS BLANCA A OLIVARES LE C/O POINTE GROUP ADVISORS RESIDENTIAL SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC RESIDENTIAL SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC CINTRON RESIDENTIAL REV TR DANETTE ANDERSON REVOCABLE TR ROBIN AMOUYAL REBECA YALE LEVIN ELISA CUADRA ARLENE L MCCREARY TRUST PROPERTIES LLC PROPERTIES LLC C/O STEPHEN H SMITH % FEDERAL REALTY INVESTMENT TR TB 3120 COMMODORE INVESTMENTS LLC URBIN COMMODORE SPE LLC(LEASEE) 3480 MAIN HIGHWAY LLC FRIT COCOWALK OWNER LLC 3162 GROVE LLC SIVEL PROPERTIES LLC 3206 GRAND AVENUE LLC VIRGINIA ARDELL STIRRUP REFERENCE ONLY 3162 COMMODORE LLC GROUPER COMMODORE 3162 LLC 3162 GROVE LLC 3162 GROVE LLC 3162 GROVE LLC THOMAS DEAN I<ENNEDY URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL RUTH W & JOSEPH L FALK & 3131 COMMODORE PLAZA 3462 MAIN HIGHWAY LLC GRAND AVENUE PLAZA LLC JULIO C MATA GREGORY DEUTCH CRISTIAN DEL RIO TB 3138 COMMODORE INVESTMENTS LLC C/O FEDERAL REALTY INVESTMENTTR % FEDERAL REALTY INVESTMENTTR SPE LLC SPE LLC SPE LLC JUDITH S RICHARD % FEDERAL REALTY INVESTMENTTR MARIA C MATA LAUREN DEUTCH VIVIANNE DEL RIO MAI LI NG_BLOCK_LIN E3 20040 NW 13 CT PO BOX 330024 3211 THOMAS AVE 8325 SW 54 AVE 8325 SW 54 AVE 3439 MAIN HWY 8325 SW 54 AVE 3155 FLORIDA AVE 121 ALHAMBRA PLAZA PH1 3350 VIRGINIA ST 225 NO HUMPHREYS BLVD 1410 NE 2 AVE 2525 PONCE DE LEON BLVD FL 9 9755 SW 40 TER 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 3444 MAIN HGWY # 9 344 MAIN HWY 2 FLOOR 2525 PONCE DE LEON BLVD FL 9 2900 OAK AVE 2900 OAK AVE 20900 NE 30 AVE STE 600 1050 NE 86 ST 3350 MARY ST 3429 DEVON RD 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 3444 MAIN HIGHWAY 2 FLOOR 2525 PONCE DE LEON BLVD FL 9 3160 OAK AVE 3182 OAK AVE UNIT 3182 3439 MAIN HWY 1110 BRICKELL AVE 200 444 SW 2ND AVE 3RD FLOOR 250 GIRALDA AVE 2525 PONCE DE LEON BLVD FL 9 3162 COMMODORE PLAZA 2F 2525 PONCE DE LEON BLVD FL 9 3840 MAIN HWY 3155 FLORIDA AVE 2980 MCFARLANE RD 299 ALHAMBRA CIR STE 510 3197 FLORIDA AVE 8325 SW 54 AVE 225 NO HUMPHREYS BLVD 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 9755 SW 40 TER MAI LI NG_BLOCK_LIN E4 MIAMI, FL 33169 MIAMI, FL 33233-0024 MIAMI, FL 33133 MIAMI, FL 33143 MIAMI, FL 33143 MIAMI, FL 33133-5915 MIAMI, FL 33143 MIAMI, FL 33133 CORAL GABLES, FL 33134 COCONUT GROVE, FL 33133 MEMPHIS, TN 38166 MIAMI, FL 33132-1308 CORAL GABLES, FL 33134-6039 MIAMI, FL 33165 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 MIAMI, FL 33133 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 MIAMI, FL 33133 AVENTURA, FL 33180 MIAMI, FL 33138 MIAMI, FL 33133 COCONUT GROVE, FL 33133-6201 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133-5915 MIAMI, FL 33131 MIAMI, FL 33130-1910 CORAL GABLES, FL 33134 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 COCONUT GROVE, FL 33133 MIAMI, FL 33133 CORAL GABLES, FL 33134 MIAMI, FL 33173 MIAMI, FL 33143 MEMPHIS, TN 38166 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 MIAMI, FL 33165 3350 MARY ST PO BOX 33-1850 PO BOX 431436 225 NO HUMPHREYS BLVD 225 NO HUMPHREYS BLVD 3439 MAIN HWY 3141 COMMODORE PLZ 14342 76 ST 3121 COMMODORE PLAZE 2900 OAK AVE 1800 PURDY AVE #714 3172 OAK AVE 3172 3162 OAK AVE 3180 OAK AVE 13218 W BROWARD BLVD 2980 MCFARLANE RD 12 3444 MAIN HIGHWAY 2 FLOOR 737 CAMILO AVE 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 9755 SW 40 TER 9755 SW 40 TER 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD 9TH FL 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 3220 FLORIDA AVE 3166 OAI< AVE 3166 3175 FLORIDA AVE 3175 3177 FLORIDA AVE # 3177 3192 OAK AVE 620 HARBOR CIR 3173 FLORIDA AVE 2811 EMATHIA ST 8325 SW 54 AVE 444 SW 2ND AVE 3RD FLOOR 3189 FLORIDA AVE 8325 SW 54 AVE 8325 SW 54 AVE 4277 INGRAHAM HWY 225 NO HUMPHREYS BLVD 8600 NW 17 ST STE 110 2900 OAI< AVE 909 ROSE AVENUE SUITE 200 PO BOX 331330 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33243 MEMPHIS, TN 38166 MEMPHIS, TN 38166 MIAMI, FL 33133-5915 MIAMI, FL 33133-5817 LIVE OAK, FL 32060 MIAMI, FL 33133-5846 MIAMI, FL 33133 MIAMI BEACH, FL 33139 COCONUT GROVE, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 PLANTATION, FL 33325 MIAMI, FL 33133 MIAMI, FL 33133 CORAL GABLES, FL 33134-7007 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 MIAMI, FL 33165 MIAMI, FL 33165 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 KEY BISCAYNE, FL 33149 MIAMI, FL 33133 MIAMI, FL 33133-3246 MIAMI, FL 33143 MIAMI, FL 33130-1910 COCONUT GROVE, FL 33133 MIAMI, FL 33143 MIAMI, FL 33143 MIAMI, FL 33133 MEMPHIS, TN 38166 DORAL, FL 33126 COCONUT GROVE, FL 33133 NORTH BETHESDA, MD 20852 MIAMI, FL 33233-1330 2665 BAYSHORE DR STE 1020 2665 SO BAYSHORE DR STE 1101 2601 S BAYSHORE DR 1450 909 ROSE AVENUE SUITE 200 3444 MAIN HIGHWAY 2 FLOOR 3444 MAIN HGWY # 9 909 ROSE AVENUE SUITE 200 2816 26 STREET 344 MAIN HWY 2 FLOOR 2980 MCFARLANE RD 12 3444 MAIN HIGHWAY 2 FLOOR 3444 MAIN HIGHWAY 2 FLOOR 3444 MAIN HIGHWAY 2 FLOOR 3162 COMMODORE PLAZA #2 G 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 1770 MICANOPY AVE 909 ROSE AVENUE SUITE 200 PO BOX 33-1850 1261 20 ST 3168 OAK AVE 3190 OAI< AVE 3170 OAK AVE COCONUT GROVE, FL 33133 COCONUT GROVE, FL 33133 MIAMI, FL 33133 NORTH BETHESDA, MD 20852 MIAMI, FL 33133 MIAMI, FL 33133 NORTH BETHESDA, MD 20852 TUSCALOOSA, AL 35401 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 COCONUT GROVE, FL 33133-3323 NORTH BETHESDA, MD 20852 MIAMI, FL 33133 MIAMI BCH, FL 33139 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 FOLIO 0141210270130 0141210320120 0141210320130 0141210290100 0141210300010 0141210320110 0141210320118 0141210320180 0141210320240 0141210430040 0141210430060 0141212830001 0141212600001 0141212600010 0141212150010 0141210470400 0141210470480 0141213130001 0141211980010 0141212150030 0141213670020 0141213130010 0141213130060 0141213320010 0141212150060 0141210320009 0141210320070 0141212830010 0141210470340 0141210470390 0141213750001 0141213850001 0141213850010 0141210470420 0141210470430 0141210470460 0141210320150 0141210320190 0141210320210 0141210320230 0141212830020 0141210430091 0141213390020 0141213670001 0141213670010 0141213320001 0141211250010 0141212150020 0141213850020 0141211440020 0141211980001 0141212150050 0141213750010 TRUE_SITE_ADDR 3061 OAK AVE 3104 FLORIDAAVE 3114 FLORIDA AVE 3293 GIFFORD LN 3131 GRAND AVE 3155 FLORIDAAVE 3100 FLORIDAAVE 3170 FLORIDAAVE 3143 GRAND AVE 3425 MAIN HWY 3419 MAIN HWY 3101 OAK AVE 3101 3101 3161 OAK AVE 3161 3161 3155 COMMODORE PLZ 3456 MAIN HWY 3282 MATILDA ST 1 3280 GIFFORD LN 3280 3123 OAK AVE 3123 3160 OAK AVE 3160 3182 OAK AVE 3182 3093 OAK AVE 3093 3290 GIFFORD LN 3290 3120 OAK AVE 3197 FLORIDAAVE 3089 OAK AVE 3089 3089 3197 COMMODORE PLZ 3157 COMMODORE PLZ 3175 FLORIDA AVE 3171 FLORIDAAVE 3171 3171 3141 COMMODORE PLZ 3133 COMMODORE PLZ 3105 COMMODORE PLZ 3150 FLORIDA AVE 3174 FLORIDA AVE 3192 FLORIDA AVE 3195 GRAND AVE 3091 OAK AVE 3091 3091 3401 MAIN HWY 3273 MATILDA ST 3273 3273 3121 OAK AVE 3121 OAK AVE 3121 3121 3444 MAIN HWY 3163 OAK AVE 3163 3173 FLORIDAAVE 3173 3291 MATILDA ST 2 3288 GIFFORD LN 3288 3288 3175 FLORIDA AVE 3175 3175 TRUE_SITE_UNIT TRUE_SITE_CITY Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami 1 Miami 3280 Miami 3123 Miami 3160 Miami 3182 Miami 3093 Miami 3290 Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami 3163 Miami 3173 Miami 2 Miami Miami Miami Miami TRUE_SITE_ZIP_CODE 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 0141213750020 0141213130020 0141213130050 0141213130030 0141210270140 0141210270150 0141210290101 0141213390001 0141213390010 0141210161090 0141210300020 0141210320010 0141210320080 0141210320140 0141210320160 0141210320170 0141210430031 0141210430070 0141210440010 0141210440030 0141210470410 0141210470440 0141210440011 0141213960020 0141211260010 0141211440001 0141211440010 0141211980020 0141210470470 0141213130040 0141213320020 0141213870020 0141213960001 0141213870001 0141213870010 0141213960010 0141212600020 0141212150001 0141212150040 3177 FLORIDA AVE 3177 3177 Miami 33133-0000 3162 OAK AVE 3162 3162 Miami 33133-0000 3180 OAK AVE 3180 3180 Miami 33133-0000 3166 OAK AVE 3166 3166 Miami 33133-0000 3071 OAK AVE Miami 33133-0000 3081 OAK AVE Miami 33133-0000 3129 OAK AVE Miami 33133-0000 Miami 33133-0000 3271 MATILDA ST 3271 3271 Miami 33133-0000 3067 GRAND AVE Miami 33133-0000 3101 GRAND AVE Miami 33133-0000 3152 OAK AVE Miami 33133-0000 3189 FLORIDA AVE Miami 33133-0000 3124 FLORIDA AVE Miami 33133-0000 3158 FLORIDA AVE Miami 33133-0000 3160 FLORIDA AVE Miami 33133-0000 3435 MAIN HWY Miami 33133-0000 3423 MAIN HWY Miami 33133-0000 3406 MAIN HWY Miami 33133-0000 3432 MAIN HWY Miami 33133-0000 3145 COMMODORE PLZ Miami 33133-0000 3131 COMMODORE PLZ Miami 33133-0000 3418 MAIN HWY Miami 33133-0000 3172 OAK AVE 3172 3172 Miami 33133-0000 3015 GRAND AVE Miami 33133-0000 Miami 33133-0000 3099 OAK AVE 1 1 Miami 33133-0000 3280 MATILDA ST 2 2 Miami 33133-0000 3462 MAIN HWY Miami 33133-0000 3168 OAK AVE 3168 3168 Miami 33133-0000 3095 OAK AVE 3095 3095 Miami 33133-0000 3192 OAK AVE 3192 3192 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 3190 OAK AVE 3190 3190 Miami 33133-0000 3170 OAK AVE 3170 3170 Miami 33133-0000 3103 OAK AVE 3103 3103 Miami 33133-0000 Miami 33133-0000 3282 GIFFORD LN 3282 3282 Miami 33133-0000 TRUE_OWNER1 TRUE_OWNER2 ROBERT STAHR HOSMON TRS MARK S STEINBERG TRS AYME FLORIDAAVENUE PROPERTIES LLC AYME FLORIDAAVENUE PROPERTIES LLC MARIA PIA CLEMENS TRS AYME PROPERTIES LLC STEVEN R CAPELLINI TRS THE CAPELLINI LIVING TRUST 3101 GROVE TRUSTEE LLC TRS 3101 GROVE LAND TRUST HABITUS FLORIDAAVENUE LLC US POSTAL SVC MAIN HIGHWAY LLC TRS MAIN HIGHWAY LAND TRUST MAIN HIGHWAY 3419 LLC REFERENCE ONLY REFERENCE ONLY NAZRUL I SHAIKH SYEDA Z REHMAN TODD HENDRIX YINED RAMIREZ HENDRIX PLYMOUTH CONGREGATIONAL CHURCH CHRISTIAN SCIENCE SOCIETY OF COCONUT GROVE MIAMI FLORIDA INC REFERENCE ONLY ANNE MARIE SIERRA EDWARD J HERALD JOSHUA J HELLER JARED W HELLER SEHER SAMILGIL CENKHAN SAMILGIL LUIS J MORENO ALVARO URRUTIA VICTORIA NEALE ALEJANDRO VASQUEZ TRS ALEJANDRO VASQUEZ AND AMY CITY OF MIAMI PATRICIA CJOHNSON JUSTIN M JOHNSON MICHAEL MAJOR HIGHFIELD PATRICIAJ HIGHFIELD COMMODORE CORNER LLC COMMODORE 3157 LLC REFERENCE ONLY REFERENCE ONLY INAGUA HOLDINGS INC SERGE RENARD COMMODORE PLAZA LLC 3121 COMMODORE CORP AYME FLORIDA AVE PROPERTIES LLC US POSTAL SERVICE US POSTAL SERVICE U S POSTAL SERVICE NANDA GOWDA MAIN HIGHWAY LLC TRS MAIN HIGHWAY LAND TRUST LAUREN A LERNER SARAH E LERNER REFERENCE ONLY BRIAN KATZ TARA I<ATZ REFERENCE ONLY 3140 GRAND LLC C/O POINTE GROUP ADVISORS HANSHI ZHANG SANDRA FERNANDEZ JAVIER CUADRA ELISA CUADRA ANDREW DIAMOND ERII<A C URBAN REFERENCE ONLY BENJAMIN A GLATZER MARISSA ALTMAN GLATZER PHILIPPE AMOUYAL ROBIN AMOUYAL MONICA CUELLAR TOBON SCOTTJAMES BUTLER RODRIGO A OLIVARES LE DANETTE ANDERSON TRS ROBERT STAHR HOSMON TR DANIEL J ABRIL JOHN PAULARCIA REFERENCE ONLY RENEE M THEREZE DESCLAUX JAGUAR GROVE PROPERTY INC AYME PROPERTIES LLC CITY OF MIAMI ARLENE L MCCREARY TRS AYME FLORIDAAVENUE AYME FLORIDAAVENUE CASTANHA X LLC COCONUT BUILDING INC MAIN HIGHWAY 2 LLC 3406 MAIN HIGHWAY LLC COGO LTD RUTH W & JOSEPH L FALK & 3131 COMMODORE PLAZA TOM TOWLE JR TRS DEBORAH LAURIA FRIT COCOWALK OWNER LLC REFERENCE ONLY EMMANUEL CASUSCELLI LAWRENCE COLE 3462 MAIN HIGHWAY LLC JULIO C MATA SEAN MCNAMARA BRIAN LEVIN REFERENCE ONLY REFERENCE ONLY GREGORY DEUTCH CRISTIAN DEL RIO PETER KAUFMAN REFERENCE ONLY JAMES GLOVER ELIZABETH JANE MANDERS BLANCA A OLIVARES LE DANETTE ANDERSON REVOCABLE TR JOSHUA A ABRIL ARLENE L MCCREARY TRUST PROPERTIES LLC PROPERTIES LLC C/O STEPHEN H SMITH % FEDERAL REALTY INVESTMENTTR JUDITH S RICHARD % FEDERAL REALTY INVESTMENTTR C/O FEDERAL REALTY INVESTMENTTR ANASTASIA CASUSCELLI MARIA A COLE MARIA C MATA JAYA KRUTULIS REBECA YALE LEVIN LAUREN DEUTCH VIVIANNE DEL RIO MERCEDES KAUFMAN TIFFANY GLOVER MAILING_BLOCK_LINE1 MAILING_BLOCI<_LINE2 MAILING_BLOCK_LINE3 ROBERT STAHR HOSMON TRS MARK S STEINBERG TRS 3071 OAI< AVE AYME FLORIDA AVENUE PROPERTIES LLC 8325 SW 54 AVE AYME FLORIDA AVENUE PROPERTIES LLC 8325 SW 54 AVE MARIA PIA CLEMENS TRS 3009 DAY AVE AYME PROPERTIES LLC 8325 SW 54 AVE STEVEN R CAPELLINI TRS THE CAPELLINI LIVING TRUST 3155 FLORIDA AVE 3101 GROVE TRUSTEE LLC TRS 3101 GROVE LAND TRUST 121 ALHAMBRA PLAZA PH1 HABITUS FLORIDA AVENUE LLC 3350 VIRGINIA ST US POSTAL SVC 225 NO HUMPHREYS BLVD MAIN HIGHWAY LLC TRS MAIN HIGHWAY LAND TRUST 2900OAK AVE MAIN HIGHWAY 3419 LLC 2900 OAK AVE REFERENCE ONLY REFERENCE ONLY NAZRUL I SHAIKH SYEDA Z REHMAN 3101 OAK AVENUE #3101 TODD HENDRIX YINED RAMIREZ HENDRIX 3161 OAK AVE 3161 PLYMOUTH CONGREGATIONAL CHURCH 3429 DEVON RD CHRISTIAN SCIENCE SOCIETY OF COCONUT GROVE MIAMI FLORIDA INC 3840 MAIN HWY REFERENCE ONLY ANNE MARIE SIERRA 3282 MATILDA ST 1 EDWARD J HERALD 3280 GIFFORD LANE #3280 JOSHUA J HELLER JARED W HELLER 3123 OAK AVE #3123 SEHER SAMILGIL CENKHAN SAMILGIL 3160 OAK AVE LUIS J MORENO 3182 OAK AVE UNIT 3182 ALVARO URRUTIA VICTORIA NEALE 3093 OAK AVE UNIT 3093 ALEJANDRO VASQUEZ TRS ALEJANDRO VASQUEZ AND AMY 3290 GIFFORD LN CITY OF MIAMI 444 SW 2ND AVE 3RD FLOOR PATRICIA C JOHNSON JUSTIN M JOHNSON 3197 FLORIDA AVE MICHAEL MAJOR HIGHFIELD PATRICIA J HIGHFIELD 3089 OAK AVE COMMODORE CORNER LLC PO BOX 33-1850 COMMODORE 3157 LLC PO BOX 431436 REFERENCE ONLY REFERENCE ONLY INAGUA HOLDINGS INC 620 HARBOR CIR SERGE RENARD 3141 COMMODORE PLZ COMMODORE PLAZA LLC 14342 76 ST 3121 COMMODORE CORP 3121 COMMODORE PLAZE AYME FLORIDA AVE PROPERTIES LLC 8325 SW 54 AVE US POSTAL SERVICE 225 NO HUMPHREYS BLVD US POSTAL SERVICE 225 NO HUMPHREYS BLVD U S POSTAL SERVICE 225 NO HUMPHREYS BLVD NANDA GOWDA 4012 IRVINGTON AVE MAIN HIGHWAY LLC TRS MAIN HIGHWAY LAND TRUST 2900OAK AVE LAUREN A LERNER SARAH E LERNER 3273 MATILDA ST 3273 REFERENCE ONLY BRIAN KATZ TARA I<ATZ 3121 OAK AVE 3121 REFERENCE ONLY 3140 GRAND LLC C/O POINTE GROUP ADVISORS 13218 W BROWARD BLVD HANSHI ZHANG SANDRA FERNANDEZ 3163 OAK AVE JAVIER CUADRA ELISA CUADRA 3173 FLORIDA AVE ANDREW DIAMOND ERII<A C URBAN 3291 MATILDA ST UNIT 2 REFERENCE ONLY BENJAMIN A GLATZER MARISSA ALTMAN GLATZER 3288 GIFFORD LN PHILIPPE AMOUYAL ROBIN AMOUYAL 3175 FLORIDA AVE 3175 MONICA CUELLAR TOBON SCOTTJAMES BUTLER RODRIGO A OLIVARES LE DANETTE ANDERSON TRS ROBERT STAHR HOSMON TR DANIEL J ABRIL JOHN PAULARCIA REFERENCE ONLY RENEE M THEREZE DESCLAUX JAGUAR GROVE PROPERTY INC AYME PROPERTIES LLC CITY OF MIAMI ARLENE L MCCREARY TRS AYME FLORIDAAVENUE AYME FLORIDAAVENUE CASTANHA X LLC COCONUT BUILDING INC MAIN HIGHWAY 2 LLC 3406 MAIN HIGHWAY LLC COGO LTD RUTH W & JOSEPH L FALK & 3131 COMMODORE PLAZA TOM TOWLE JR TRS DEBORAH LAURIA FRIT COCOWALK OWNER LLC REFERENCE ONLY EMMANUEL CASUSCELLI LAWRENCE COLE 3462 MAIN HIGHWAY LLC JULIO C MATA SEAN MCNAMARA BRIAN LEVIN REFERENCE ONLY REFERENCE ONLY GREGORY DEUTCH CRISTIAN DEL RIO PETER KAUFMAN REFERENCE ONLY JAMES GLOVER ELIZABETH JANE MANDERS BLANCA A OLIVARES LE DANETTE ANDERSON REVOCABLE TR JOSHUA A ABRIL ARLENE L MCCREARY TRUST PROPERTIES LLC PROPERTIES LLC C/O STEPHEN H SMITH % FEDERAL REALTY INVESTMENTTR JUDITH S RICHARD % FEDERAL REALTY INVESTMENTTR C/O FEDERAL REALTY INVESTMENTTR ANASTASIA CASUSCELLI MARIA A COLE MARIA C MATA JAYA KRUTULIS REBECA YALE LEVIN LAUREN DEUTCH VIVIANNE DEL RIO MERCEDES KAUFMAN 3177 FLORIDA AVE # 3177 3162 OAI< AVE 3180 OAK AVE 3166 OAK AVE 3166 3071 OAK AVE 3081 OAK AVE PO BOX 330927 3271 MATILDA ST 2811 EMATHIA ST 8325 SW 54 AVE 444 SW 2ND AVE 3RD FLOOR 3189 FLORIDA AVE 8325 SW 54 AVE 8325 SW 54 AVE 4277 INGRAHAM HWY 8600 NW 17 ST STE 110 2900 OAI< AVE 909 ROSE AVENUE SUITE 200 PO BOX 331330 1770 MICANOPY AVE 909 ROSE AVENUE SUITE 200 1800 PURDY AVE #714 3172 OAK AVE 3172 909 ROSE AVENUE SUITE 200 3099 OAI< AVE 1 3280 MATILDA ST 2 PO BOX 33-1850 3168 OAK AVE 3095 OAK AVE 3192 OAK AVE 3190 OAK AVE 3170 OAI< AVE 3103 OAK AVE 3103 TIFFANY GLOVER 3282 GIFFORD LN # 3282 MAI LI NG_BLOCK_LI N E4 MIAMI, FL 33133 MIAMI, FL 33143 MIAMI, FL 33143 COCONUT GROVE, FL 33133-5108 MIAMI, FL 33143 MIAMI, FL 33133 CORAL GABLES, FL 33134 COCONUT GROVE, FL 33133 MEMPHIS, TN 38166 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 COCONUT GROVE, FL 33133-6201 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133-5115 COCONUT GROVE, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33130-1910 MIAMI, FL 33173 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33243 KEY BISCAYNE, FL 33149 MIAMI, FL 33133-5817 LIVE OAK, FL 32060 MIAMI, FL 33133-5846 MIAMI, FL 33143 MEMPHIS, TN 38166 MEMPHIS, TN 38166 MEMPHIS, TN 38166 MIAMI, FL 33133-6112 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 PLANTATION, FL 33325 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 COCONUT GROVE, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133-5133 MIAMI, FL 33133 MIAMI, FL 33233 MIAMI, FL 33133 MIAMI, FL 33133-3246 MIAMI, FL 33143 MIAMI, FL 33130-1910 COCONUT GROVE, FL 33133 MIAMI, FL 33143 MIAMI, FL 33143 MIAMI, FL 33133 DORAL, FL 33126 COCONUT GROVE, FL 33133 NORTH BETHESDA, MD 20852 MIAMI, FL 33233-1330 COCONUT GROVE, FL 33133-3323 NORTH BETHESDA, MD 20852 MIAMI BEACH, FL 33139 COCONUT GROVE, FL 33133 NORTH BETHESDA, MD 20852 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 FOLIO 0141210071671 0141210073100 0141210073170 0141210090031 0141210120010 0141210120020 0141210090020 0141210320120 0141210320130 0141210161010 0141210280070 0141210290100 0141210300010 0141210320110 0141210320118 0141210320180 0141210320240 0141210470020 0141210470050 0141210470400 0141210470480 0141211310090 0141211310370 0141211310402 0141211310411 0141211310413 0141211310414 0141211310440 0141211310490 0141211950012 0141211310010 0141211310030 0141211310050 0141211310061 0141211310100 0141211980010 0141211310110 0141212150030 0141211310290 0141211310320 0141211310340 0141211310350 0141211310360 0141211310380 0141211310390 0141211310401 0141211310403 0141211310404 0141211310421 0141211310422 0141211310431 0141211310432 0141211310460 TRUE_SITE_ADDR 3310 MCDONALD ST 3220 FROW AVE 3221 FLORIDA AVE 3201 FLORIDAAVE 3201 THOMAS AVE 3211 THOMAS AVE 3340 SW 32 AVE 3104 FLORIDAAVE 3114 FLORIDAAVE 3351 MATILDA ST 3171 OAK AVE 3293 GIFFORD LN 3131 GRAND AVE 3155 FLORIDA AVE 3100 FLORIDAAVE 3170 FLORIDAAVE 3143 GRAND AVE 3190 COMMODORE PLZ 3176 COMMODORE PLZ 3155 3456 3162 3162 3162 3162 3162 3162 3162 3162 3215 3162 3162 3162 3162 3162 3282 3162 3280 3162 3162 3162 3162 3162 3162 3162 3162 3162 3162 3162 3162 3162 3162 3162 COMMODORE PLZ MAIN HWY COMMODORE PLZ 11 COMMODORE PLZ 3F COMMODORE PLZ 4B COMMODORE PLZ 4E COMMODORE PLZ 4G COMMODORE PLZ 4H COMMODORE PLZ 6A COMMODORE PLZ 6E GRAND AVE COMMODORE PLZ 1A COMMODORE PLZ 1C COMMODORE PLZ 1E COMMODORE PLZ 1F2 COMMODORE PLZ 1J MATILDA ST 1 COMMODORE PLZ 1K GIFFORD LN 3280 COMMODORE PLZ 2F COMMODORE PLZ 3A COMMODORE PLZ 3C COMMODORE PLZ 3D COMMODORE PLZ 3E COMMODORE PLZ 3G COMMODORE PLZ 3H COMMODORE PLZ 4A COMMODORE PLZ 4C COMMODORE PLZ 4D COMMODORE PLZ 5A COMMODORE PLZ 5B COMMODORE PLZ 5D COMMODORE PLZ 5E COMMODORE PLZ 6B TRUE_SITE_UNIT 11 3F 4B 4E 4G 4H 6A 6E 1A 1C 1E 1F2 1J 1 1K 3280 2F 3A 3C 3D 3E 3G 3H 4A 4C 4D 5A 5B 5D 5E 6B TRUE_SITE_CITY Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami Miami TRUE_SITE_ZIP_CODE 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 33133-0000 0141211310500 0141211310510 0141212240001 0141212240010 0141210071590 0141212600001 0141212600010 0141212150010 0141212150060 0141213130001 0141213130010 0141213130060 0141213670020 0141213750001 0141213850001 0141213850010 0141210320009 0141210320060 0141210320070 0141210320150 0141210320190 0141210320210 0141210320230 0141210440011 0141210470010 0141210470040 0141210470060 0141210470340 0141210470390 0141210470420 0141210470430 0141210470460 0141213130020 0141213130050 0141213340001 0141213340010 0141213670001 0141213670010 0141213850020 0141213960020 0141211250010 0141211310001 0141211310080 0141211310240 0141211310310 0141211310330 0141211310423 0141211310470 0141211440020 0141211950014 0141211980001 0141212150020 0141212150050 0141212240020 3162 COMMODORE PLZ 6F 6F 3162 COMMODORE PLZ 6H 6H 3191 OAK AVE 3191 3208 OAK AVE 3101 OAK AVE 3101 3161 OAK AVE 3161 3290 GIFFORD LN 3290 3160 OAK AVE 3160 3182 OAK AVE 3182 3123 OAK AVE 3123 3175 FLORIDAAVE 3191 3101 3161 3290 3160 3182 3123 3171 FLORIDAAVE 3171 3171 3120 OAK AVE 3301 MCDONALD ST 3197 FLORIDAAVE 3150 FLORIDA AVE 3174 FLORIDAAVE 3192 FLORIDA AVE 3195 GRAND AVE 3418 MAIN HWY 3194 COMMODORE PLZ 3180 COMMODORE PLZ 3170 COMMODORE PLZ 3197 COMMODORE PLZ 3157 COMMODORE PLZ 3141 COMMODORE PLZ 3133 COMMODORE PLZ 3105 COMMODORE PLZ 3162 OAK AVE 3162 3162 3180 OAK AVE 3180 3180 3181 OAK AVE 3181 3181 3121 OAK AVE 3121 OAK AVE 3121 3121 3173 FLORIDAAVE 3173 3173 3172 OAK AVE 3172 3172 3444 MAIN HWY 3162 COMMODORE PLZ 1H 3162 COMMODORE PLZ 2A 3162 COMMODORE PLZ 2H 3162 COMMODORE PLZ 3B 3162 COMMODORE PLZ 5C 3162 COMMODORE PLZ 6C 3291 MATILDA ST 2 3220 FLORIDAAVE 3163 OAK AVE 3163 3288 GIFFORD LN 3288 3193 OAK AVE 3193 1H 2A 2H 3B 5C 6C 2 3163 3288 3193 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 0141213130030 0141213340020 0141213750010 0141213750020 0141213870020 0141213960001 0141210074480 0141210074500 0141210090010 0141210090030 0141210120030 0141210161090 0141210280060 0141210290101 0141210300020 0141210320010 0141210320080 0141210320140 0141210320160 0141210320170 0141210320220 0141210440030 0141210470120 0141210470130 0141210470410 0141210470440 0141210470470 0141211310020 0141211310040 0141211310060 0141211310070 0141211310250 0141211310260 0141211310270 0141211310300 0141211310412 0141211310433 0141211310480 0141211440001 0141211440010 0141211950010 0141211980020 0141212150001 0141212150040 0141212600020 0141213130040 0141213870001 0141213870010 0141213960010 3166 OAK AVE 3166 3183 OAK AVE 3183 3175 FLORIDAAVE 3175 3177 FLORIDA AVE 3177 3192 OAK AVE 3192 3166 3183 3175 3177 3192 3206 GRAND AVE 3214 GRAND AVE 3200 FROW AVE 3346 MCDONALD ST 3221 THOMAS AVE 3067 GRAND AVE 3170 LAMB CT 3129 OAK AVE 3101 GRAND AVE 3152 OAK AVE 3189 FLORIDAAVE 3124 FLORIDA AVE 3158 FLORIDAAVE 3160 FLORIDAAVE 3365 SW 32 AVE 3432 MAIN HWY 3120 COMMODORE PLZ 3138 COMMODORE PLZ 3145 COMMODORE PLZ 3131 COMMODORE PLZ 3462 MAIN HWY 3162 COMMODORE PLZ 1B 1B 3162 COMMODORE PLZ 1D 1D 3162 COMMODORE PLZ 1F1 1F1 3162 COMMODORE PLZ 1G 1G 3162 COMMODORE PLZ 2B 2B 3162 COMMODORE PLZ 2C 2C 3162 COMMODORE PLZ 2D 2D 3162 COMMODORE PLZ 2G 2G 3162 COMMODORE PLZ 4F 4F 3162 COMMODORE PLZ 5F 5F 3162 COMMODORE PLZ 6D 6D 3099 OAK AVE 1 3211 GRAND AVE 3280 MATILDA ST 2 3282 GIFFORD LN 3282 3103 OAK AVE 3103 3168 OAK AVE 3168 1 2 3282 3103 3168 3190 OAK AVE 3190 3190 3170 OAK AVE 3170 3170 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 Miami 33133-0000 TRUE_OWNER1 CARLOS ALBERTO MIER 3220 FROW INC CARL KESSER JESSIE HARVIN JR JORGE L MORALES SCOTT CHORMANSKI ELISHAMA WITHERS AYME FLORIDAAVENUE PROPERTIES AYME FLORIDAAVENUE BOARD OF PUBLIC INSTRUCTION EDWARD R BUELL II MARIA PIA CLEMENS TRS AYME PROPERTIES LLC STEVEN R CAPELLINI TRS 3101 GROVE TRUSTEE LLC TRS HABITUS FLORIDAAVENUE LLC US POSTAL SVC 3190 COMMODORE LLC MAA REAL ESTATE LLC PLYMOUTH CONGREGATIONAL CHURCH CHRISTIAN SCIENCE SOCIETY OF URBIN COMMODORE PREMIUM SPACE HOLDINGS LLC URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL SCP 2007 C27 008 LLC 3162 GROVE LLC URBIN COMMODORE SIVEL PROPERTIES LLC 3162 COMMODORE LLC URBIN COMMODORE ANNE MARIE SIERRA URBIN COMMODORE EDWARD J HERALD PATRICK GARELLE INTL CORP URBIN COMMODORE URBIN COMMODORE URBIN COMMODORE PREMIUM SPACE HOLDINGS LLC PREMIUM SPACE HOLDINGS LLC PREMIUM SPACE HOLDINGS LLC URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL TRUE_OWNER2 VIRGINIA HARVIN THERESAANN CHORMANSKI LLC PROPERTIES LLC THE CAPELLINI LIVING TRUST 3101 GROVE LAND TRUST COCONUT GROVE MIAMI FLORIDA INC RESIDENTIAL SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC C/O CVS #4994-01/STORE ACCT RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC RESIDENTIAL SPE LLC SPE LLC SPE LLC URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL REFERENCE ONLY PATRICIA WARMAN KYLE RYAN REFERENCE ONLY NAZRUL I SHAIKH TODD HENDRIX ALEJANDRO VASQUEZ TRS REFERENCE ONLY SEHER SAMILGIL LUIS J MORENO JOSHUA J HELLER REFERENCE ONLY REFERENCE ONLY INAGUA HOLDINGS INC CITY OF MIAMI 3301 MCDONALD STREET LLC PATRICIA C JOHNSON AYME FLORIDA AVE PROPERTIES LLC US POSTAL SERVICE US POSTAL SERVICE U S POSTAL SERVICE TOM TOWLE JR TRS COMMODORE GRAND LLC AVENUE GROUPER ART GALLERY LLC URBIN COMMODORE COMMODORE CORNER LLC COMMODORE 3157 LLC SERGE RENARD COMMODORE PLAZA LLC 3121 COMMODORE CORP SCOTTJAMES BUTLER RODRIGO A OLIVARES LE REFERENCE ONLY EDUARDO ATANACIO PEREZ TRS REFERENCE ONLY BRIAN KATZ JAVIER CUADRA DEBORAH LAURIA 3140 GRAND LLC REFERENCE ONLY GROUPER COMMODORE 3162 LLC 3162 GROVE LLC ERIC S COPELAND &W CLAUDIA M URBIN COMMODORE URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL ANDREW DIAMOND LUIS GABRIEL CINTRON TRS REFERENCE ONLY HANSHI ZHANG BENJAMIN A GLATZER GABRIELA M GUIMARAES SPE LLC SPE LLC CHRISTINA WILLIAMS SYEDA Z REHMAN YINED RAMIREZ HENDRIX ALEJANDRO VASQUEZ AND AMY CENI<HAN SAMILGIL JARED W HELLER JUSTIN M JOHNSON RESIDENTIAL II SPE LLC ELIZABETH JANE MANDERS BLANCA A OLIVARES LE EDUARDO ATANACIO PEREZ REV TR TARA KATZ ELISA CUADRA C/O POINTE GROUP ADVISORS RESIDENTIAL SPE LLC SPE LLC SPE LLC ERIKA C URBAN CINTRON RESIDENTIAL REV TR SANDRA FERNANDEZ MARISSA ALTMAN GLATZER DANETTE ANDERSON TRS DANETTE ANDERSON REVOCABLE TR ALISON R JOSLYN PHILIPPE AMOUYAL ROBIN AMOUYAL MONICA CUELLAR TOBON BRIAN LEVIN REBECA YALE LEVIN REFERENCE ONLY 3206 GRAND AVENUE LLC % FEDERAL REALTY INVESTMENTTR GRAND AVENUE OFFICES LLC VERTHELIA C SANDILANDS SANDRA SPETKO &H MICHAEL A SPETKO VIRGINIA ARDELL STIRRUP JAGUAR GROVE PROPERTY INC MICHAEL A CAVIGLIA JOHN PAULARCIA AYME PROPERTIES LLC CITY OF MIAMI ARLENE L MCCREARY TRS ARLENE L MCCREARY TRUST AYME FLORIDAAVENUE PROPERTIES LLC AYME FLORIDAAVENUE PROPERTIES LLC CASTANHA X LLC C/O STEPHEN H SMITH U S POSTAL SERVICE COGO LTD TB 3120 COMMODORE INVESTMENTS LLC URBIN COMMODORE SPE LLC(LEASEE) TB 3138 COMMODORE INVESTMENTS LLC RUTH W & JOSEPH L FALK & JUDITH S RICHARD 3131 COMMODORE PLAZA % FEDERAL REALTY INVESTMENTTR 3462 MAIN HIGHWAY LLC 3162 GROVE LLC SIVEL PROPERTIES LLC 3162 COMMODORE LLC GROUPER COMMODORE 3162 LLC 3162 GROVE LLC 3162 GROVE LLC 3162 GROVE LLC THOMAS DEAN KENNEDY URBIN COMMODORE RESIDENTIAL SPE LLC URBIN COMMODORE RESIDENTIAL SPE LLC URBIN COMMODORE RESIDENTIAL SPE LLC REFERENCE ONLY EMMANUEL CASUSCELLI ANASTASIA CASUSCELLI GRAND AVENUE PLAZA LLC LAWRENCE COLE MARIA A COLE REFERENCE ONLY JAMES GLOVER TIFFANY GLOVER PETER KAUFMAN MERCEDES KAUFMAN JULIO C MATA MARIA C MATA REFERENCE ONLY GREGORY DEUTCH LAUREN DEUTCH CRISTIAN DEL RIO VIVIANNE DEL RIO MAI LI NG_BLOCK_LIN E1 CARLOS ALBERTO MIER 3220 FROW INC CARL KESSER JESSIE HARVIN JR JORGE L MORALES SCOTT CHORMANSKI ELISHAMA WITHERS AYME FLORIDAAVENUE PROPERTIES AYME FLORIDAAVENUE BOARD OF PUBLIC INSTRUCTION EDWARD R BUELL II MARIA PIA CLEMENS TRS AYME PROPERTIES LLC STEVEN R CAPELLINI TRS 3101 GROVE TRUSTEE LLC TRS HABITUS FLORIDAAVENUE LLC US POSTAL SVC 3190 COMMODORE LLC MAA REAL ESTATE LLC PLYMOUTH CONGREGATIONAL CHURCH CHRISTIAN SCIENCE SOCIETY OF URBIN COMMODORE PREMIUM SPACE HOLDINGS LLC URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL SCP 2007 C27 008 LLC 3162 GROVE LLC URBIN COMMODORE SIVEL PROPERTIES LLC 3162 COMMODORE LLC URBIN COMMODORE ANNE MARIE SIERRA URBIN COMMODORE EDWARD J HERALD PATRICK GARELLE INTL CORP URBIN COMMODORE URBIN COMMODORE URBIN COMMODORE PREMIUM SPACE HOLDINGS LLC PREMIUM SPACE HOLDINGS LLC PREMIUM SPACE HOLDINGS LLC URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL URBIN COMMODORE URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL MAI LI NG_BLOCK_LI N E2 VIRGINIA HARVIN THERESAANN CHORMANSKI LLC PROPERTIES LLC THE CAPELLINI LIVING TRUST 3101 GROVE LAND TRUST COCONUT GROVE MIAMI FLORIDA INC RESIDENTIAL SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC C/O CVS #4994-01/STORE ACCT RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC RESIDENTIAL SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC SPE LLC RESIDENTIAL SPE LLC SPE LLC SPE LLC URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL REFERENCE ONLY PATRICIA WARMAN KYLE RYAN REFERENCE ONLY NAZRUL I SHAIKH TODD HENDRIX ALEJANDRO VASQUEZ TRS REFERENCE ONLY SEHER SAMILGIL LUIS J MORENO JOSHUA J HELLER REFERENCE ONLY REFERENCE ONLY INAGUA HOLDINGS INC CITY OF MIAMI 3301 MCDONALD STREET LLC PATRICIA C JOHNSON AYME FLORIDA AVE PROPERTIES LLC US POSTAL SERVICE US POSTAL SERVICE U S POSTAL SERVICE TOM TOWLE JR TRS COMMODORE GRAND LLC AVENUE GROUPER ART GALLERY LLC URBIN COMMODORE COMMODORE CORNER LLC COMMODORE 3157 LLC SERGE RENARD COMMODORE PLAZA LLC 3121 COMMODORE CORP SCOTTJAMES BUTLER RODRIGO A OLIVARES LE REFERENCE ONLY EDUARDO ATANACIO PEREZ TRS REFERENCE ONLY BRIAN KATZ JAVIER CUADRA DEBORAH LAURIA 3140 GRAND LLC REFERENCE ONLY GROUPER COMMODORE 3162 LLC 3162 GROVE LLC ERIC S COPELAND &W CLAUDIA M URBIN COMMODORE URBIN COMMODORE RESIDENTIAL URBIN COMMODORE RESIDENTIAL ANDREW DIAMOND LUIS GABRIEL CINTRON TRS REFERENCE ONLY HANSHI ZHANG BENJAMIN A GLATZER GABRIELA M GUIMARAES SPE LLC SPE LLC CHRISTINA WILLIAMS SYEDA Z REHMAN YINED RAMIREZ HENDRIX ALEJANDRO VASQUEZ AND AMY CENI<HAN SAMILGIL JARED W HELLER JUSTIN M JOHNSON RESIDENTIAL II SPE LLC ELIZABETH JANE MANDERS BLANCA A OLIVARES LE EDUARDO ATANACIO PEREZ REV TR TARA KATZ ELISA CUADRA C/O POINTE GROUP ADVISORS RESIDENTIAL SPE LLC SPE LLC SPE LLC ERIKA C URBAN CINTRON RESIDENTIAL REV TR SANDRA FERNANDEZ MARISSA ALTMAN GLATZER DANETTE ANDERSON TRS DANETTE ANDERSON REVOCABLE TR ALISON R JOSLYN PHILIPPE AMOUYAL ROBIN AMOUYAL MONICA CUELLAR TOBON BRIAN LEVIN REBECA YALE LEVIN REFERENCE ONLY 3206 GRAND AVENUE LLC % FEDERAL REALTY INVESTMENTTR GRAND AVENUE OFFICES LLC VERTHELIA C SANDILANDS SANDRA SPETKO &H MICHAEL A SPETKO VIRGINIA ARDELL STIRRUP JAGUAR GROVE PROPERTY INC MICHAEL A CAVIGLIA JOHN PAULARCIA AYME PROPERTIES LLC CITY OF MIAMI ARLENE L MCCREARY TRS ARLENE L MCCREARY TRUST AYME FLORIDAAVENUE PROPERTIES LLC AYME FLORIDAAVENUE PROPERTIES LLC CASTANHA X LLC C/O STEPHEN H SMITH U S POSTAL SERVICE COGO LTD TB 3120 COMMODORE INVESTMENTS LLC URBIN COMMODORE SPE LLC(LEASEE) TB 3138 COMMODORE INVESTMENTS LLC RUTH W & JOSEPH L FALK & JUDITH S RICHARD 3131 COMMODORE PLAZA % FEDERAL REALTY INVESTMENTTR 3462 MAIN HIGHWAY LLC 3162 GROVE LLC SIVEL PROPERTIES LLC 3162 COMMODORE LLC GROUPER COMMODORE 3162 LLC 3162 GROVE LLC 3162 GROVE LLC 3162 GROVE LLC THOMAS DEAN KENNEDY URBIN COMMODORE RESIDENTIAL SPE LLC URBIN COMMODORE RESIDENTIAL SPE LLC URBIN COMMODORE RESIDENTIAL SPE LLC REFERENCE ONLY EMMANUEL CASUSCELLI ANASTASIA CASUSCELLI GRAND AVENUE PLAZA LLC LAWRENCE COLE MARIA A COLE REFERENCE ONLY JAMES GLOVER TIFFANY GLOVER PETER KAUFMAN MERCEDES KAUFMAN JULIO C MATA MARIA C MATA REFERENCE ONLY GREGORY DEUTCH LAUREN DEUTCH CRISTIAN DEL RIO VIVIANNE DEL RIO MAI LI NG_BLOCK_LIN E3 4060 VENTURA AVE 3650 NW 82 AVE 206 3221 FLORIDA AVE 20040 NW 13 CT PO BOX 330024 3211 THOMAS AVE 3340 SW 32 AVE 8325 SW 54 AVE 8325 SW 54 AVE 1410 NE 2 AVE 3171 OAK AVE 3009 DAY AVE 8325 SW 54 AVE 3155 FLORIDA AVE 121 ALHAMBRA PLAZA PH1 3350 VIRGINIA ST 225 NO HUMPHREYS BLVD 20900 NE 30 AVE STE 600 1050 NE 86 ST 3429 DEVON RD 3840 MAIN HWY 2525 PONCE DE LEON BLVD FL 9 9755 SW 40 TER 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 1 CVS DRIVE 3444 MAIN HIGHWAY 2 FLOOR 2525 PONCE DE LEON BLVD FL 9 3444 MAIN HGWY # 9 344 MAIN HWY 2 FLOOR 2525 PONCE DE LEON BLVD FL 9 3282 MATILDA ST 1 2525 PONCE DE LEON BLVD FL 9 3280 GIFFORD LANE #3280 3162 COMMODORE PLAZA 2F 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 9755 SW 40 TER 9755 SW 40 TER 9755 SW 40 TER 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 MAI LI NG_BLOCK_LIN E4 MIAMI, FL 33133 DORAL, FL 33166 MIAMI, FL 33133 MIAMI, FL 33169 MIAMI, FL 33233-0024 MIAMI, FL 33133 COCONUT GROVE, FL 33133-5135 MIAMI, FL 33143 MIAMI, FL 33143 MIAMI, FL 33132-1308 MIAMI, FL 33133-5134 COCONUT GROVE, FL 33133-5108 MIAMI, FL 33143 MIAMI, FL 33133 CORAL GABLES, FL 33134 COCONUT GROVE, FL 33133 MEMPHIS, TN 38166 AVENTURA, FL 33180 MIAMI, FL 33138 COCONUT GROVE, FL 33133-6201 MIAMI, FL 33133 CORAL GABLES, FL 33134-6039 MIAMI, FL 33165 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 WOONSOCKET, RI 02895 MIAMI, FL 33133 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 MIAMI, FL 33133 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 CORAL GABLES, FL 33134-6039 COCONUT GROVE, FL 33133-5115 MIAMI, FL 33133 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 MIAMI, FL 33165 MIAMI, FL 33165 MIAMI, FL 33165 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 2525 PONCE DE LEON BLVD 9TH FL CORAL GABLES, FL 33134 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 3191 OAK AVE #3191 3208 OAK AVE 3101 OAK AVENUE #3101 3161 OAK AVE 3161 3290 GIFFORD LN 3160 OAI< AVE 3182 OAK AVE UNIT 3182 3123 OAK AVE #3123 620 HARBOR CIR 444 SW 2ND AVE 3RD FLOOR 250 GIRALDA AVE 3197 FLORIDA AVE 8325 SW 54 AVE 225 NO HUMPHREYS BLVD 225 NO HUMPHREYS BLVD 225 NO HUMPHREYS BLVD 1800 PURDY AVE #714 3155 FLORIDA AVE 2980 MCFARLANE RD 299 ALHAMBRA CIR STE 510 PO BOX 33-1850 PO BOX 431436 3141 COMMODORE PLZ 14342 76 ST 3121 COMMODORE PLAZE 3162 OAK AVE 3180 OAK AVE 3181 OAI< AVE 3181 3121 OAK AVE 3121 3173 FLORIDA AVE 3172 OAI< AVE 3172 13218 W BROWARD BLVD 2980 MCFARLANE RD 12 3444 MAIN HIGHWAY 2 FLOOR 737 CAMILO AVE 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 3291 MATILDA ST UNIT 2 3220 FLORIDA AVE 3163 OAI< AVE 3288 GIFFORD LN 3193 OAK AVE CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 KEY BISCAYNE, FL 33149 MIAMI, FL 33130-1910 CORAL GABLES, FL 33134 MIAMI, FL 33173 MIAMI, FL 33143 MEMPHIS, TN 38166 MEMPHIS, TN 38166 MEMPHIS, TN 38166 MIAMI BEACH, FL 33139 COCONUT GROVE, FL 33133 MIAMI, FL 33133 CORAL GABLES, FL 33134 MIAMI, FL 33133 MIAMI, FL 33243 MIAMI, FL 33133-5817 LIVE OAI<, FL 32060 MIAMI, FL 33133-5846 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 PLANTATION, FL 33325 MIAMI, FL 33133 MIAMI, FL 33133 CORAL GABLES, FL 33134-7007 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 MIAMI, FL 33133 3166 OAK AVE 3166 3183 OAK AVE 3175 FLORIDA AVE 3175 3177 FLORIDA AVE # 3177 3192 OAK AVE 909 ROSE AVENUE SUITE 200 PO BOX 565775 3200 FROW AVE 5951 NW 151 ST UNIT 100 2816 26 STREET 2811 EMATHIA ST 3170 LAMB CT PO BOX 330927 8325 SW 54 AVE 444 SW 2ND AVE 3RD FLOOR 3189 FLORIDA AVE 8325 SW 54 AVE 8325 SW 54 AVE 4277 INGRAHAM HWY 225 NO HUMPHREYS BLVD PO BOX 331330 2665 BAYSHORE DR STE 1020 2665 SO BAYSHORE DR STE 1101 1770 MICANOPY AVE 909 ROSE AVENUE SUITE 200 PO BOX 33-1850 3444 MAIN HIGHWAY 2 FLOOR 3444 MAIN HGWY # 9 344 MAIN HWY 2 FLOOR 2980 MCFARLANE RD 12 3444 MAIN HIGHWAY 2 FLOOR 3444 MAIN HIGHWAY 2 FLOOR 3444 MAIN HIGHWAY 2 FLOOR 3162 COMMODORE PLAZA #2 G 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 2525 PONCE DE LEON BLVD FL 9 3099 OAI< AVE 1 1261 20 ST 3280 MATILDA ST 2 3282 GIFFORD LN # 3282 3103 OAK AVE 3103 3168 OAK AVE 3190 OAK AVE 3170 OAK AVE MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 NORTH BETHESDA, MD 20852 MIAMI, FL 33256 MIAMI, FL 33133 MIAMI LAKES, FL 33014 TUSCALOOSA, AL 35401 MIAMI, FL 33133-3246 COCONUT GROVE, FL 33133 MIAMI, FL 33233 MIAMI, FL 33143 MIAMI, FL 33130-1910 COCONUT GROVE, FL 33133 MIAMI, FL 33143 MIAMI, FL 33143 MIAMI, FL 33133 MEMPHIS, TN 38166 MIAMI, FL 33233-1330 COCONUT GROVE, FL 33133 COCONUT GROVE, FL 33133 COCONUT GROVE, FL 33133-3323 NORTH BETHESDA, MD 20852 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 CORAL GABLES, FL 33134-6039 MIAMI, FL 33133 MIAMI BCH, FL 33139 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 MIAMI, FL 33133 COCONUT GROVE, FL 33133 Dear Constituent: Welcome to the City of Miami! This package is intended to provide you with all open Code Enforcement violations and liens attached to the subject property, or properties, as of the current date and time the following report was created. Closed violations and future violations are not included. A violation may become a lien when the property owner does not timely remedy the violation. This report may include two types of liens: Certified liens and non -certified liens. Certified liens have a set amount to be paid. Conversely, most non -certified liens continue to accrue interest or a per diem fine; therefore, those liens must be satisfied with the City as quickly as possible. All outstanding violations and liens must be satisfactorily resolved before the City can issue a Certificate of Use (CU); however, the City inspects all properties prior to the issuance of a CU and those inspections may yield additional items, which must be addressed by the owner at the property prior to issuance of a CU. This search does not include encumbrances, other liens, restrictions or the like, recorded in the Public Records of Miami -Dade County, Florida. Please contact Miami -Dade County for the aforementioned items. Code Violation/Lien Inquiry Letter Page 1 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Property Search Notice Per your request (copy attached), the undersigned has searched the records of the Director of Finance in and for the City of Miami, Florida, for any liens and other fees outstanding against the following described property as of: 10/26/2025. The result is valid up to 30 days from the processing date. In addition, due to daily penalty and interest calculations, the amount shown is subject to change as reflected below. Folio Number: Property Address: Legal Description: Amount Payable On: 01-4121-032-0118 3100 FLORIDA AV CHAS H FROWS SUB PB 13-53 LOT 1 LESS E & N FT BLK 2 LOT SIZE 7068 SQ FT OR 17766-3683 0797 4 10/25/2025 to 11/25/2025 0.00 This notice does not include liens imposed by federal, state, county or City agencies or boards or any other liens recorded in the public records of Miami -Dade County. Erica T. Paschal Finance Director To ensure proper credit of your payment, include a copy of all pages of the property search findings along with your payment and mail to: City of Miami, Treasury Management/Payment Processing, 444 SW 2nd Avenue, 6th Floor, Room 636-1, Miami, FL 33130. If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 2 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Folio Number: 01-4121-032-0118 Property Address: 3100 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 1 LESS E & N FT BLK 2 LOT SIZE 7068 SQ FT OR 17766-3683 0797 4 Property Search Findings — Pending Liens (Case Number) Lien No. Description Address If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 3 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Folio Number: 01-4121-032-0118 Property Address: 3100 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 1 LESS E & N FT BLK 2 LOT SIZE 7068 SQ FT OR 17766-3683 0797 4 Property Search Findings - Open Invoices Invoice Customer No. (Case Number) Lien No. Description Amount Due Sub -Total 0.00 If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 4 of 5 Violations Detail Report Folio Number: 01-4121-032-0118 NO OPEN VIOLATIONS FOUND. Page 5 of 5 Dear Constituent: Welcome to the City of Miami! This package is intended to provide you with all open Code Enforcement violations and liens attached to the subject property, or properties, as of the current date and time the following report was created. Closed violations and future violations are not included. A violation may become a lien when the property owner does not timely remedy the violation. This report may include two types of liens: Certified liens and non -certified liens. Certified liens have a set amount to be paid. Conversely, most non -certified liens continue to accrue interest or a per diem fine; therefore, those liens must be satisfied with the City as quickly as possible. All outstanding violations and liens must be satisfactorily resolved before the City can issue a Certificate of Use (CU); however, the City inspects all properties prior to the issuance of a CU and those inspections may yield additional items, which must be addressed by the owner at the property prior to issuance of a CU. This search does not include encumbrances, other liens, restrictions or the like, recorded in the Public Records of Miami -Dade County, Florida. Please contact Miami -Dade County for the aforementioned items. Code Violation/Lien Inquiry Letter Page 1 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/11/2025 Property Search Notice Per your request (copy attached), the undersigned has searched the records of the Director of Finance in and for the City of Miami, Florida, for any liens and other fees outstanding against the following described property as of: 09/11/2025. The result is valid up to 30 days from the processing date. In addition, due to daily penalty and interest calculations, the amount shown is subject to change as reflected below. Folio Number: 01-4121-032-0120 Property Address: 3104 FLORIDA AV Legal Description: CHARLES H FROWS SUB PB 13-53 LOT 2 BLK 2 LOT SIZE IRREGULAR COC 26356-1584 04 2008 5 Amount Payable On: 09/10/2025 to 10/11/2025 0.00 This notice does not include liens imposed by federal, state, county or City agencies or boards or any other liens recorded in the public records of Miami -Dade County. Erica T. Paschal Finance Director To ensure proper credit of your payment, include a copy of all pages of the property search findings along with your payment and mail to: City of Miami, Treasury Management/Payment Processing, 444 SW 2nd Avenue, 6th Floor, Room 636-1, Miami, FL 33130. If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 2 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/ 11 /2025 Folio Number: 01-4121-032-0120 Property Address: 3104 FLORIDA AV Legal Description: CHARLES H FROWS SUB PB 13-53 LOT 2 BLK 2 LOT SIZE IRREGULAR COC 26356-1584 04 2008 5 Property Search Findings — Pending Liens (Case Number) Lien No. Description Address If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 3 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/11/2025 Folio Number: 01-4121-032-0120 Property Address: 3104 FLORIDA AV Legal Description: CHARLES H FROWS SUB PB 13-53 LOT 2 BLK 2 LOT SIZE IRREGULAR COC 26356-1584 04 2008 5 Property Search Findings - Open Invoices Invoice Customer No. (Case Number) Lien No. Description Amount Due Sub -Total 0.00 If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 4 of 5 Violations Detail Report Folio Number: 01-4121-032-0120 NO OPEN VIOLATIONS FOUND. Page 5 of 5 Dear Constituent: Welcome to the City of Miami! This package is intended to provide you with all open Code Enforcement violations and liens attached to the subject property, or properties, as of the current date and time the following report was created. Closed violations and future violations are not included. A violation may become a lien when the property owner does not timely remedy the violation. This report may include two types of liens: Certified liens and non -certified liens. Certified liens have a set amount to be paid. Conversely, most non -certified liens continue to accrue interest or a per diem fine; therefore, those liens must be satisfied with the City as quickly as possible. All outstanding violations and liens must be satisfactorily resolved before the City can issue a Certificate of Use (CU); however, the City inspects all properties prior to the issuance of a CU and those inspections may yield additional items, which must be addressed by the owner at the property prior to issuance of a CU. This search does not include encumbrances, other liens, restrictions or the like, recorded in the Public Records of Miami -Dade County, Florida. Please contact Miami -Dade County for the aforementioned items. Code Violation/Lien Inquiry Letter Page 1 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/11/2025 Property Search Notice Per your request (copy attached), the undersigned has searched the records of the Director of Finance in and for the City of Miami, Florida, for any liens and other fees outstanding against the following described property as of: 09/11/2025. The result is valid up to 30 days from the processing date. In addition, due to daily penalty and interest calculations, the amount shown is subject to change as reflected below. Folio Number: 01-4121-032-0130 Property Address: 3114 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 3 BLK 2 LOT SIZE 50.000 X 145 OR 16237-3214 1293 5 Amount Payable On: 09/10/2025 to 10/11/2025 0.00 This notice does not include liens imposed by federal, state, county or City agencies or boards or any other liens recorded in the public records of Miami -Dade County. Erica T. Paschal Finance Director To ensure proper credit of your payment, include a copy of all pages of the property search findings along with your payment and mail to: City of Miami, Treasury Management/Payment Processing, 444 SW 2nd Avenue, 6th Floor, Room 636-1, Miami, FL 33130. If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 2 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/ 11 /2025 Folio Number: 01-4121-032-0130 Property Address: 3114 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 3 BLK 2 LOT SIZE 50.000 X 145 OR 16237-3214 1293 5 Property Search Findings — Pending Liens (Case Number) Lien No. Description Address If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 3 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/11/2025 Folio Number: 01-4121-032-0130 Property Address: 3114 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 3 BLK 2 LOT SIZE 50.000 X 145 OR 16237-3214 1293 5 Property Search Findings - Open Invoices Invoice Customer No. (Case Number) Lien No. Description Amount Due Sub -Total 0.00 If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 4 of 5 Violations Detail Report Folio Number: 01-4121-032-0130 NO OPEN VIOLATIONS FOUND. Page 5 of 5 Dear Constituent: Welcome to the City of Miami! This package is intended to provide you with all open Code Enforcement violations and liens attached to the subject property, or properties, as of the current date and time the following report was created. Closed violations and future violations are not included. A violation may become a lien when the property owner does not timely remedy the violation. This report may include two types of liens: Certified liens and non -certified liens. Certified liens have a set amount to be paid. Conversely, most non -certified liens continue to accrue interest or a per diem fine; therefore, those liens must be satisfied with the City as quickly as possible. All outstanding violations and liens must be satisfactorily resolved before the City can issue a Certificate of Use (CU); however, the City inspects all properties prior to the issuance of a CU and those inspections may yield additional items, which must be addressed by the owner at the property prior to issuance of a CU. This search does not include encumbrances, other liens, restrictions or the like, recorded in the Public Records of Miami -Dade County, Florida. Please contact Miami -Dade County for the aforementioned items. Code Violation/Lien Inquiry Letter Page 1 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/11/2025 Property Search Notice Per your request (copy attached), the undersigned has searched the records of the Director of Finance in and for the City of Miami, Florida, for any liens and other fees outstanding against the following described property as of: 09/11/2025. The result is valid up to 30 days from the processing date. In addition, due to daily penalty and interest calculations, the amount shown is subject to change as reflected below. Folio Number: Property Address: Legal Description: Amount Payable On: 01-4121-032-0140 3124 FLORIDA AV CHAS H FROWS SUB PB 13-53 LOT 4 BLK 2 LOT SIZE IRREGULAR COC 21968-3667 09/03/22995-2851 09/10/2025 to 10/11/2025 0.00 This notice does not include liens imposed by federal, state, county or City agencies or boards or any other liens recorded in the public records of Miami -Dade County. Erica T. Paschal Finance Director To ensure proper credit of your payment, include a copy of all pages of the property search findings along with your payment and mail to: City of Miami, Treasury Management/Payment Processing, 444 SW 2nd Avenue, 6th Floor, Room 636-1, Miami, FL 33130. If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 2 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/ 11 /2025 Folio Number: 01-4121-032-0140 Property Address: 3124 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 4 BLK 2 LOT SIZE IRREGULAR COC 21968-3667 09/03/22995-2851 Property Search Findings — Pending Liens (Case Number) Lien No. Description Address If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 3 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/11/2025 Folio Number: 01-4121-032-0140 Property Address: 3124 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 4 BLK 2 LOT SIZE IRREGULAR COC 21968-3667 09/03/22995-2851 Property Search Findings - Open Invoices Invoice Customer No. (Case Number) Lien No. Description Amount Due Sub -Total 0.00 If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 4 of 5 Violations Detail Report Folio Number: 01-4121-032-0140 NO OPEN VIOLATIONS FOUND. Page 5 of 5 Dear Constituent: Welcome to the City of Miami! This package is intended to provide you with all open Code Enforcement violations and liens attached to the subject property, or properties, as of the current date and time the following report was created. Closed violations and future violations are not included. A violation may become a lien when the property owner does not timely remedy the violation. This report may include two types of liens: Certified liens and non -certified liens. Certified liens have a set amount to be paid. Conversely, most non -certified liens continue to accrue interest or a per diem fine; therefore, those liens must be satisfied with the City as quickly as possible. All outstanding violations and liens must be satisfactorily resolved before the City can issue a Certificate of Use (CU); however, the City inspects all properties prior to the issuance of a CU and those inspections may yield additional items, which must be addressed by the owner at the property prior to issuance of a CU. This search does not include encumbrances, other liens, restrictions or the like, recorded in the Public Records of Miami -Dade County, Florida. Please contact Miami -Dade County for the aforementioned items. Code Violation/Lien Inquiry Letter Page 1 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/11/2025 Property Search Notice Per your request (copy attached), the undersigned has searched the records of the Director of Finance in and for the City of Miami, Florida, for any liens and other fees outstanding against the following described property as of: 09/11/2025. The result is valid up to 30 days from the processing date. In addition, due to daily penalty and interest calculations, the amount shown is subject to change as reflected below. Folio Number: 01-4121-032-0150 Property Address: 3150 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 5 BLK 2 LOT SIZE 50.000 X 148 OR 19686-1380 05/2001 1 COC 26400-2354 05 2008 5 Amount Payable On: 09/10/2025 to 10/11/2025 0.00 This notice does not include liens imposed by federal, state, county or City agencies or boards or any other liens recorded in the public records of Miami -Dade County. Erica T. Paschal Finance Director To ensure proper credit of your payment, include a copy of all pages of the property search findings along with your payment and mail to: City of Miami, Treasury Management/Payment Processing, 444 SW 2nd Avenue, 6th Floor, Room 636-1, Miami, FL 33130. If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 2 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/ 11 /2025 Folio Number: 01-4121-032-0150 Property Address: 3150 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 5 BLK 2 LOT SIZE 50.000 X 148 OR 19686-1380 05/2001 1 COC 26400-2354 05 2008 5 Property Search Findings — Pending Liens (Case Number) Lien No. Description Address If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 3 of 5 City of Miami Javier Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 09/11/2025 Folio Number: 01-4121-032-0150 Property Address: 3150 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 5 BLK 2 LOT SIZE 50.000 X 148 OR 19686-1380 05/2001 1 COC 26400-2354 05 2008 5 Property Search Findings - Open Invoices Invoice Customer No. (Case Number) Lien No. Description Amount Due Sub -Total 0.00 If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 4 of 5 Violations Detail Report Folio Number: 01-4121-032-0150 NO OPEN VIOLATIONS FOUND. Page 5 of 5 Dear Constituent: Welcome to the City of Miami! This package is intended to provide you with all open Code Enforcement violations and liens attached to the subject property, or properties, as of the current date and time the following report was created. Closed violations and future violations are not included. A violation may become a lien when the property owner does not timely remedy the violation. This report may include two types of liens: Certified liens and non -certified liens. Certified liens have a set amount to be paid. Conversely, most non -certified liens continue to accrue interest or a per diem fine; therefore, those liens must be satisfied with the City as quickly as possible. All outstanding violations and liens must be satisfactorily resolved before the City can issue a Certificate of Use (CU); however, the City inspects all properties prior to the issuance of a CU and those inspections may yield additional items, which must be addressed by the owner at the property prior to issuance of a CU. This search does not include encumbrances, other liens, restrictions or the like, recorded in the Public Records of Miami -Dade County, Florida. Please contact Miami -Dade County for the aforementioned items. Code Violation/Lien Inquiry Letter Page 1 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Property Search Notice Per your request (copy attached), the undersigned has searched the records of the Director of Finance in and for the City of Miami, Florida, for any liens and other fees outstanding against the following described property as of: 10/26/2025. The result is valid up to 30 days from the processing date. In addition, due to daily penalty and interest calculations, the amount shown is subject to change as reflected below. Folio Number: Property Address: Legal Description: Amount Payable On: 01-4121-032-0160 3158 FLORIDA AV CHAS H FROWS SUB PB 13-53 LOT 6 BLK 2 LOT SIZE 50.000 X 148 OR 19144-2304 05 2000 1 COC 21697-3541 09 2003 1 10/25/2025 to 11/25/2025 0.00 This notice does not include liens imposed by federal, state, county or City agencies or boards or any other liens recorded in the public records of Miami -Dade County. Erica T. Paschal Finance Director To ensure proper credit of your payment, include a copy of all pages of the property search findings along with your payment and mail to: City of Miami, Treasury Management/Payment Processing, 444 SW 2nd Avenue, 6th Floor, Room 636-1, Miami, FL 33130. If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 2 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Folio Number: 01-4121-032-0160 Property Address: 3158 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 6 BLK 2 LOT SIZE 50.000 X 148 OR 19144-2304 05 2000 1 COC 21697-3541 09 2003 1 Property Search Findings — Pending Liens (Case Number) Lien No. Description Address If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 3 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Folio Number: 01-4121-032-0160 Property Address: 3158 FLORIDA AV Legal Description: CHAS H FROWS SUB PB 13-53 LOT 6 BLK 2 LOT SIZE 50.000 X 148 OR 19144-2304 05 2000 1 COC 21697-3541 09 2003 1 Property Search Findings - Open Invoices Invoice Customer No. (Case Number) Lien No. Description Amount Due Sub -Total 0.00 If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 4 of 5 Violations Detail Report Folio Number: 01-4121-032-0160 NO OPEN VIOLATIONS FOUND. Page 5 of 5 Dear Constituent: Welcome to the City of Miami! This package is intended to provide you with all open Code Enforcement violations and liens attached to the subject property, or properties, as of the current date and time the following report was created. Closed violations and future violations are not included. A violation may become a lien when the property owner does not timely remedy the violation. This report may include two types of liens: Certified liens and non -certified liens. Certified liens have a set amount to be paid. Conversely, most non -certified liens continue to accrue interest or a per diem fine; therefore, those liens must be satisfied with the City as quickly as possible. All outstanding violations and liens must be satisfactorily resolved before the City can issue a Certificate of Use (CU); however, the City inspects all properties prior to the issuance of a CU and those inspections may yield additional items, which must be addressed by the owner at the property prior to issuance of a CU. This search does not include encumbrances, other liens, restrictions or the like, recorded in the Public Records of Miami -Dade County, Florida. Please contact Miami -Dade County for the aforementioned items. Code Violation/Lien Inquiry Letter Page 1 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Property Search Notice Per your request (copy attached), the undersigned has searched the records of the Director of Finance in and for the City of Miami, Florida, for any liens and other fees outstanding against the following described property as of: 10/26/2025. The result is valid up to 30 days from the processing date. In addition, due to daily penalty and interest calculations, the amount shown is subject to change as reflected below. Folio Number: Property Address: Legal Description: Amount Payable On: 01-4121-030-0020 3101 GRAND AV 21 54 41 0.37 AC M/L HAAS PROPERTIES PB 51-65 TRACT B LOT SIZE 16152 SQUARE FEET OR 15617-0645 0792 4 10/31/2025 to 11/25/2025 2,159.74 This notice does not include liens imposed by federal, state, county or City agencies or boards or any other liens recorded in the public records of Miami -Dade County. Erica T. Paschal Finance Director To ensure proper credit of your payment, include a copy of all pages of the property search findings along with your payment and mail to: City of Miami, Treasury Management/Payment Processing, 444 SW 2nd Avenue, 6th Floor, Room 636-1, Miami, FL 33130. If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 2 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Folio Number: 01-4121-030-0020 Property Address: 3101 GRAND AV Legal Description: 21 54 41 0.37 AC M/L HAAS PROPERTIES PB 51-65 TRACT B LOT SIZE 16152 SQUARE FEET OR 15617-0645 0792 4 Property Search Findings — Pending Liens (Case Number) Lien No. Description Address If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 3 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Folio Number: 01-4121-030-0020 Property Address: 3101 GRAND AV Legal Description: 21 54 41 0.37 AC M/L HAAS PROPERTIES PB 51-65 TRACT B LOT SIZE 16152 SQUARE FEET OR 15617-0645 0792 4 Property Search Findings - Open Invoices Invoice Customer No. (Case Number) Lien No. Description Amount Due 9664316 43673 Certificate of Use 308.50 9661597 149291 Certificate of Use 308.50 9594160 232612 Certificate of Use 264.39 9665971 149291 Business Tax Receipt - Regular 258.50 9663574 232612 Certificate of Use 211.50 981889 31854 Burglar Alarm Permit Renewal 30.00 517566 43675 (00586115) Returned Checks 671.00 517565 43674 (00533717) Returned Checks 53.00 Sub -Total $ 2,105.39 If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 4 of 5 Violations Detail Report Folio Number: 01-4121-030-0020 NO OPEN VIOLATIONS FOUND. Page 5 of 5 Dear Constituent: Welcome to the City of Miami! This package is intended to provide you with all open Code Enforcement violations and liens attached to the subject property, or properties, as of the current date and time the following report was created. Closed violations and future violations are not included. A violation may become a lien when the property owner does not timely remedy the violation. This report may include two types of liens: Certified liens and non -certified liens. Certified liens have a set amount to be paid. Conversely, most non -certified liens continue to accrue interest or a per diem fine; therefore, those liens must be satisfied with the City as quickly as possible. All outstanding violations and liens must be satisfactorily resolved before the City can issue a Certificate of Use (CU); however, the City inspects all properties prior to the issuance of a CU and those inspections may yield additional items, which must be addressed by the owner at the property prior to issuance of a CU. This search does not include encumbrances, other liens, restrictions or the like, recorded in the Public Records of Miami -Dade County, Florida. Please contact Miami -Dade County for the aforementioned items. Code Violation/Lien Inquiry Letter Page 1 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Property Search Notice Per your request (copy attached), the undersigned has searched the records of the Director of Finance in and for the City of Miami, Florida, for any liens and other fees outstanding against the following described property as of: 10/26/2025. The result is valid up to 30 days from the processing date. In addition, due to daily penalty and interest calculations, the amount shown is subject to change as reflected below. Folio Number: Property Address: Legal Description: Amount Payable On: 01-4121-030-0010 3131 GRAND AV 21 54 41 0.31 AC M/L HAAS PROPERTIES PB 51-65 TRACT A LOT SIZE 13500 SQUARE FEET OR 15617-0645 0792 4 10/31/2025 to 11/25/2025 2,195.30 This notice does not include liens imposed by federal, state, county or City agencies or boards or any other liens recorded in the public records of Miami -Dade County. Erica T. Paschal Finance Director To ensure proper credit of your payment, include a copy of all pages of the property search findings along with your payment and mail to: City of Miami, Treasury Management/Payment Processing, 444 SW 2nd Avenue, 6th Floor, Room 636-1, Miami, FL 33130. If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 2 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Folio Number: 01-4121-030-0010 Property Address: 3131 GRAND AV Legal Description: 21 54 41 0.31 AC M/L HAAS PROPERTIES PB 51-65 TRACT A LOT SIZE 13500 SQUARE FEET OR 15617-0645 0792 4 Property Search Findings — Pending Liens (Case Number) Lien No. Description Address If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 3 of 5 City of Miami Javier E Fernandez SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables FL 33134 10/26/2025 Folio Number: 01-4121-030-0010 Property Address: 3131 GRAND AV Legal Description: 21 54 41 0.31 AC M/L HAAS PROPERTIES PB 51-65 TRACT A LOT SIZE 13500 SQUARE FEET OR 15617-0645 0792 4 Property Search Findings - Open Invoices Invoice Customer No. (Case Number) Lien No. Description Amount Due 9662988 156120 Certificate of Use 361.50 9600276 150683 Business Tax Receipt - Regular 278.14 9575594 150683 Certificate of Use 264.39 978556 205847 Burglar Alarm False Alarm Fee 213.50 9645153 150683 Certificate of Use 211.50 978519 205847 Burglar Alarm False Alarm Fee 161.00 978599 205847 Burglar Alarm False Alarm Fee 161.00 979060 205847 Burglar Alarm False Alarm Fee 161.00 978314 205847 Burglar Alarm False Alarm Fee 108.50 9669693 150683 Business Tax Receipt - Regular 102.50 985576 205847 Burglar Alarm Permit Renewal 82.50 978281 205847 Burglar Alarm False Alarm Fee 56.00 Sub -Total $ 2,161.53 If you have any questions, please call (305) 416-1570. Please retain this page for your records. Page 4 of 5 Violations Detail Report Folio Number: 01-4121-030-0010 NO OPEN VIOLATIONS FOUND. Page 5 of 5 GROVE CONDO LLC DEVELOPMENT AGREEMENT PZD-0 INDEX OF DOCUMENTS PAP-1 Application PZD-1 Signed Letter of Intent PZD-4 Development Agreement PZD-4.1 Development Agreement Exhibit B — Kirk Munroe Park Conceptual Plans PZD-4.2 Development Agreement Exhibit C — Fuller Street Conceptual Plans PZD-5 Legal Description of the Properties Subject to the Development Agreement PZD-6 Complete List of All Folio Numbers & Property Addresses HB-2 Acknowledgement by Applicant HB-3 Lobbyist Registration HB-4 Affidavit of Authority to Act HB-5 Disclosure of Agreement to Support or Withhold Objection HB-6 Disclosure of Ownership HB-7 Disclosure of Contract Purchasers HB-8 Certificate of Status HB-9 Powers of Attorney (Owners) HB-10 Power of Attorney (Contract Purchaser) HB-13 Disclosure Affidavit of No Monies Due to the City HB-15 Signed Attestation HB-16 Complete List of All Property Owners HB-17 Lien Search Report HB-18 Proof of Payment of Invoice SM GQ ATTORNEYS SMGQLAW.COM October 24, 2025 Via E-Plan Mr. David Snow, Planning Director Planning Department City of Miami 444 S.W. 2nd Avenue, 3rd Floor Miami, FL 33130 Re: Ziggurat Coconut Grove — 3101 Grand Avenue, et. al., Miami, FL (the "Property") Project Development Agreement Dear Mr. Snow: Our firm represents Coconut Grove Condo, LLC (hereinafter, "Applicant"), which is the contract purchaser of the assemblage comprised the parcels set forth in PZD-6 which comprise the Property. Applicant submits this development agreement for the City of Miami's ("City") review and approval. Applicant is proposing to construct a mixed -use project on the Property consisting of 19 luxury residential dwelling units ("Residential Component"), approximately 100,000 square feet of Class A office space ("Office Component"), and ground floor retail and food & beverage establishments across two (2) buildings housing the Residential and Office Components (the "Project"). The Project is presently being reviewed by the City Planning Department (the "Department") pursuant to Warrant Application No. PZ- 25-19525 and is seeking relief from the maximum lot size limitations for the T4-L portions of the Property on which the Residential Component is being constructed. In all other respects, the Project is being constructed consistent with the requirements of the governing transect zone regulations. Applicant has proffered this Development Agreement (the "Agreement") to facilitate the certain public benefits, specifically enhancements to Fuller Street and Kirk Munroe Park, which it has proffered to partially underwrite and execute both the design and construction of on behalf of the City. The improvements will benefit the Project and substantially enhance these public amenities for the benefit of the City and area residents. We look forward to the City's favorable determination regarding the Project's Warrant and this Agreement. Respectfully submitted, Javier E. Fernandez For the Firm SANCHEZ-MED]NA, GONZALEZ, LAGE, GOMEZ & MACHADO, LLP I SMGQLAW_COM 201 ALHAMBRA CIRCLE, SUITE 1205, CORAL GABLES, FL 33134 TEL: 305.377.1000 FAX: B55.327.0391 K MUNROE PARK CONCEPT DESIGN NATURALFICIAL LANDSCAPE ARCHITECTURE + DESIGN CONCEPT SITE PLAN HITTING WALL P NrrNE 3 ROSSWALK FIT ESS AREo PLANTING ORNAMENTAL FENCE FOR TENNIS COURTS TENNIS STORAGE PLA TING KIRK MUNROE PARK I CONCEPT BOOKLET CONCEPT SITE PLAN NATURALFICIAL,INC. www.naturalficial.com RENDERINGS 5 KIRK MUNROE PARK I CONCEPT BOOKLET RENDERED PLAN NATURALFICIAL,INC. www.naturalficial.com 6 KIRK MUNROE PARK I CONCEPT BOOKLET NATURALFICIAL,INC. www.naturalficial.com 7 KIRK MUNROE PARK I CONCEPT BOOKLET NATURALFICIAL,INC. www.naturalficial.com 8 KIRK MUNROE PARK I CONCEPT BOOKLET NATURALFICIAL,INC. www.naturalficial.com 9 KIRK MUNROE PARK I CONCEPT BOOKLET NATURALFICIAL,INC. www.naturalficial.com 10 KIRK MUNROE PARK I CONCEPT BOOKLET NATURALFICIAL,INC. www.naturalficial.com 11 KIRK MUNROE PARK I CONCEPT BOOKLET NATURALFICIAL,INC. www.naturalficial.com 12 KIRK MUNROE PARK I CONCEPT BOOKLET N AT U RALF ICIAL,INC. www.naturalficial.com THANK YOU! ,iii7 APIPF. --=" . i rar. -4021r. w=5Emain = .... kw . . #.' ° , draIMPF AMIrAIMPAINV . r.... ■ M 1 M. . . - - ' • , . ; , .M. . . i di I I P r A M FA I M I FA AIIIIMIMEM• KM KM *•- '' Aar' AMIN AIMMMAIIINIIIII M MERU MOMINIEn _ ,iidirr AMKAIVAWAIIIIIAIIMIA=7 . W,1IIMMMir .1111M11111111711 - —.••011." ilWMAdWAIWMAIimAIMIWIMIM1MllnIIWI.dlikMfl. .......priimidiallv' AINFAWAWAWAIWAWAMMIPM==MOnMIMM,MIMWIM6, , , . _4111EIPSIIIMIVAIIIIMPIWAINIMMINFMAIMW="1111=====•111111111M1h, , .0 ,iarzimmriirlimirsAmirAwmsairaiummummammuk-mosimb... ,ddPPAiPvAdrmrANPrAorAwmwAmmmmmmnmiwwimiwuL. AWAIWA/AWAilrAIAWAIFMMMAIIWMIIIIIIIIMMVIEIMIII111LWWIML. IWAAWM'AMIANFAIrANIAIFAII/111111111111 MillIMILIMIILWOMML AMPIWAWAIFAIPFAFMMMMINM 11111111KINIIMIEMIKW d r- taal Vi k°' - p.M1 JEW- SIL I' ,i ..imF LiimL ni I kl I • I I 1 "..fl =1".. , •-- r 1 • 4311' -A ea i# _.E VIIIIMISI1flONNI.11•111.flflWOMIlk OMPP"...0J.K ' AFF ME AIMPANW 4,MERM,1.1%16L IMLIMMII.WW1=171....4 -..i0 .diMPriiiiiiiirAMPr AMFAIWAMMIIM111•111 fll g I I KM I I ZI 1 I I al I N I 6 .7 ■ . . .` i IlWr " .,....iiiiiii ,diwirrmrP-mramrmAmrAmP2m2mlimrmum..mkumak miim...win...-w. .....ppuiniwia - , gii, F mmmi a N mg Pm • PrA I rm i i i m 1 M i 1 fl 1 I I I 1 kl V I MI I Lma M I k‘ I 1 I I I .11Ml I M WI I • ii,..-q im , - . d IN P" w '- d 1 i P P P "- i i i 1 P PMA d I PSI I WA Mr.4 WAMA M I r 11NAM Min 1 I MI I MMN I M LWII . I k i:I I I • I i r r °PAP 111EMMI1 lliWA WI I WAWA/111 p AffiagrifirAirak This instrument prepared by and after recording return to: Javier E. Fernandez, Esq. SMGQ Law 201 Alhambra Circle, Ste. 1205 Coral Gables, FL 33134 DEVELOPMENT AGREEMENT BETWEEN THE CITY OF MIAMI, FLORIDA AND COCONUT GROVE CONDO, LLC REGARDING THE DEVELOPMENT OF ZIGGARUT MIXED -USE PROJECT AND RELATED PUBLIC IMPROVEMENTS WITH THE PRINCIPAL ADDRESS OF 3101 GRAND AVENUE, MIAMI, FL. THIS AGREEMENT is entered into the day of , 2025, by and between COCONUT GROVE CONDO, LLC, a Delaware limited liability company ("Developer") and the CITY OF MIAMI, FLORIDA, a municipal corporation and subdivision of the State of Florida ("City") (the Developer and the City together referred as the "Parties"). WITNESSETH: WHEREAS, Owners (as described hereinbelow) have amassed property totaling approximately 72,300 sq. ft. (1.66 acres +/-) of land within the Coconut Grove neighborhood of the City bounded by Grand Avenue on the South, Florida Avenue on the North, and Matilda Street on the East, which property is described in the attached and incorporated Exhibit A; and WHEREAS, Owners through Developer propose to construct a mixed -use project, which project shall be comprised of an Office Building, a 19-unit for -sale condominium residential building, both with ground floor retail and supported by underground parking, to be known as the Ziggarut (hereinafter, the "Project"); and WHEREAS, Developer and City wish to collaborate to execute certain Public Improvements to the City Property that will enhance the quality of the neighborhood's amenities. NOW, THEREFORE, in consideration of the mutual covenants and agreements hereinafter contained, the Parties mutually agree and bind themselves as set forth herein: Section 1. Consideration. The Parties hereby agree that the consideration and obligations recited and provided for under this Agreement constitute substantial benefits to both Parties and thus adequate consideration for this Agreement. Section 2. provided: (a) (b) Rules of Construction. For all purposes of the Agreement, unless otherwise expressly A defined term has the meaning ascribed to it; Words in the singular include the plural, and words in the plural include the singular; 1 (c) A pronoun in one gender includes and applies to other genders as well; (d) The terms "hereunder," "herein," "hereof," "hereto," and such other terms shall refer to the instant Agreement in its entirety and not to individual sections or articles; (e) The Parties hereto agree that this Agreement shall not be more strictly construed against either the City or Owner, as all Parties are drafters of this Agreement; and (f) The recitals are true and correct and are incorporated into and made part of this Agreement. The attached exhibits shall be deemed adopted and incorporated into the Agreement; provided, however, that this Agreement shall be deemed to control in the event of any conflict between the attachments and this Agreement. Section 3. Definitions. Capitalized terms which are not specifically defined herein shall have the meaning given in Ordinance No. 13114, the Zoning Ordinance of the City of Miami, Florida, as amended ("Miami 21 Code") or the Code of the City of Miami, Florida, as amended ("Code" or "City Code"). "Agreement" means this Agreement between the City and Owner. "BID" refers to the Coconut Grove Business Improvement District, a semi -autonomous board of the City. "City" means the City of Miami, Florida, a municipal corporation and political subdivisions of the State of Florida, and all departments, agencies, and instrumentalities subject to the jurisdiction thereof. "City Contribution" shall have the meaning ascribed to this term in Section 11(c) of this Agreement. "City Park" means the city park commonly referred to as "Kirk Munroe Park" and identified as 3120 and 3152 Oak Avenue, Miami, Florida (Folio Nos. 01-4121-032-0009 and 01-4121-032-0010) and comprised of Lots 1, 2, 3, 4, 19, 20, 21, 22, 23, & 24 and Lots 5 & 6, less the North 5 feet for right-of-way of Block 1, Charles H. Frow Subdivision, as recorded in Plat Book 13, Page 53, Public Records of Miami -Dade County, Florida "City Property" means the: (i) the City Park; (ii) the public right-of-way known as "Fuller Street" located between Main Highway and Grand Avenue; and (iii) portions of the following City rights -of -way from the center line to the base building line: (a) the eastern portion of the Matilda Street between Grand and Oak Avenues; (b) the southern portion of Oak Avenue from Matilda Street to the western boundary of the Park; and (c) the northern portion of Florida Avenue from Matilda Street to the western boundary of the Park. "Code" means the City Charter and Code of the City of Miami, Florida, as amended. "Comprehensive Plan" means the comprehensive plan known as the Miami Comprehensive Neighborhood Plan, adopted by the City pursuant to Chapter 163, Florida Statutes (2025), meeting the requirements of Section 163.3177, Florida Statutes (2025), Section 163.3178, Florida Statutes (2025). 2 "Developer" means Coconut Grove Condo, LLC a Delaware limited liability company. "Developer Contribution" shall have the meaning ascribed to this term in Section 11(c) of this Agreement. "Development Management Agreement" shall have the meaning ascribed to this term in Section 11(e) of this Agreement. "DOSP" or "MPA" means the City's Department of Off -Street Parking also known as the Miami Parking Authority. "Effective Date" means the date of recordation of this executed Agreement in the public records of Miami -Dade County, Florida. "Existing Zoning" means (a) Miami 21 Code; and (b) laws and policies of the City that regulate any aspect of development and includes any local government zoning, rezoning, subdivision, building construction, or sign regulations or any other regulations controlling the development of land, including those provision related to the development of land in Chapters 10, 23, 35, 36, 54, 55, and 62 of the Code, as amended, through the Effective Date, which together comprise the effective land development regulations governing the development of the property. "Fuller Street Improvements" shall have the meaning ascribed to the term in Section 11(b) of this Agreement. "Land" means the earth, water, and air, above, below, or on the surface and includes any improvements or structures customarily regarded as land. "Laws" means all ordinances, resolutions, regulations, comprehensive plans, development regulations, and rules adopted by a local government affecting the development of land. "Owner(s)" means AYME Properties, LLC, a Florida limited liability company (hereinafter, "AYME"), AYME Florida Avenue Properties, LLC, a Florida limited liability company ("AYME Florida"), and 3101 Grove Trustee, LLC, a Delaware limited liability company, both individually and collectively. "Park Budget" shall have the meaning ascribed to this term in Section 12 of this Agreement. "Park Fund" shall have the meaning ascribed to this term in Section 12 of this Agreement. "Park Improvements" the term shall have the meaning ascribed to the term in Section 11(a) of the Agreement. "Parties" means the Developer and the City, both of whom are signatories to the Agreement. "Project" shall have the meaning ascribed in the Recitals. "Property" means the parcels more specifically described in Exhibit A to this Agreement and which is more commonly referred to as 3101 & 3131 Grand Avenue and 3100, 3104, 3114, 3124, 3150 & 3158 Florida Avenue, all located within the City of Miami, Florida. 3 "Public Facilities" means major capital improvements, including, but not limited to, transportation, sanitary sewer, solid waste, drainage, potable water, educational, parks and recreational, streets, parking, and health systems and facilities. "Public Improvements" means the improvements to the City Property, inclusive of the Park Improvements and Fuller Street Improvements, to be designed and constructed by Developer for the benefit of the City and jointly financed with contributions from the Parties consistent with the terms set forth hereinbelow. "Public Improvements Contribution" means the sum of the City Contribution and the Developer Contribution. "Public Improvements Cost Estimate" shall have the meaning ascribed to the term in Section 11(c) of the Agreement. "Revised Public Improvements Cost Estimate" shall have the meaning ascribed to the term in Section 11(c) of this Agreement. "Term" means the duration of this Agreement which shall commence on the Effedive Date and continue in force for 30 years thereafter, or expiration or termination of the same, consistent with the authority provided pursuant to s. 163.3229, Florida Statutes (2025). Section 4. Purpose. The purpose of this Agreement is for the City to authorize Developer to redevelop the Property pursuant to the terms of the Miami 21 Code and the City Code and enlist the Developer's assistance with the design, construction and financing of the Public Improvements adjacent to Owner's property. This Agreement will establish, as of the Effedive Date of this Agreement, the land development regulations that will govern the development of the Property and design, construction and financing of the Public Improvements, thereby providing the Parties with additional certainty during the development process. Section 5. Intent. Developer and City intend for this Agreement to be construed and implemented so as to effectuate the purpose of the Comprehensive Plan, Existing Zoning, and the Florida Local Government Development Agreement Ad, s. 163.3220 —163.3243, Florida Statutes (2025). Section 6. Applicability. This Agreement only applies to the Property described in Exhibit A. Section 7. Term of Agreement, Effedive Date and Binding Effect. This Agreement shall be for a minimum term of thirty (30) years from the Effedive Date and shall be recorded in the public records of Miami -Dade County with a recorded copy filed with the City Clerk. The Term may be extended by mutual consent of the Parties subject to public hearing(s), pursuant to the authority granted in s. 163.3229, Florida Statutes (2025), and consistent with the hearing requirements set forth in s. 163.3225, Florida Statutes (2025). The Agreement shall become effective on the Effective Date and shall constitute a covenant running with the land that shall be binding upon, and inure to the benefit of, the Parties, their successors, assigns, heirs, legal representatives, and personal representatives. 4 Section 8. Permitted Development Uses and Building Intensities. (a) Density, Intensity, Uses, and Building Heights. (1) As of the Effective Date, the intensity, Uses, and Building Heights proposed for the Project are consistent with the intensities, Uses, and Building Heights permitted by the Existing Zoning and the Comprehensive Plan. (2) Nothing herein shall prohibit the Developer from soliciting a change of zoning, pursuant to the requirements of Article 7 of Miami 21, to increase the density or intensity of development permitted on the Property, as long as such increase in density or intensity is consistent with the Comprehensive Plan and the procedures established in Miami 21 as they exist on the Effective Date. (3) Nothing herein shall prohibit the Developer from requesting approval of a qualifying project on the Property pursuant to the Section 166.04151, Florida Statutes (2025) (the "Live Local Act"), as the same may be amended from time to time. (b) Environmental. The Developer shall be required to comply with the requirements of Chapter 17 of the City Code, subject to the modifications set forth herein, by performing tree replacement within the BID and within the City Park where possible. (1) Off -site replacement trees. Notwithstanding the requirements of Sec. 17-6.(e), Code, where replacement within the Property is not reasonably feasible, Developer may enter into an agreement with the City to perform tree replacement on public property in the following order of priority: (i) within City Park; (ii) on Fuller Street between Main Highway and Grand Avenue; (iii) within the boundaries of the BID; (iv) within one (1) mile of the boundaries of the BID; or (v) within any City -owned park. The City further agrees to facilitate the permitting and planting of replacement trees on all publicly -owned property within the aforementioned areas and within City parks. Should Developer undertake any tree replacement off -site for the Property, it shall agree to, or make arrangements for the provision, of water, trim, root, prune, brace, or undertake any other necessary maintenance as may be required for by the Department of Resilience & Public Works and/or the Division Environmental Resources for a period of not greater than one hundred eighty (180) days following installation. Developer shall further warrant every off -site replacement tree for a period of one (1) year following the date of installation. (2) Tree installation, maintenance and guarantee. For all trees placed at the Property or its abutting right-of-way, Developer shall install any needed irrigation and corresponding water meters required to support the growth of the right-of-way trees. Developer shall water, trim, root, prune, brace or undertake any other necessary maintenance as may be required for such trees located within the boundaries of the BID and shall warrant such trees for a period of one (1) year following installation. (c) Parking Requirements. The Property is located within the boundaries of "Coconut Grove Village Center" described in Sec. 35-221, Code, which area is benefited by the Coconut Grove Parking Trust Fund administered by the Department of Off -Street Parking ("DOSP" or "MPA"). Developer 5 intends to avail itself of the use of parking waiver certificates to satisfy, in part, its off-street parking requirements for the Project. Notwithstanding the language in Sec. 35-221.(e), Code, regarding "food service establishments," parking requirements for Commercial Uses, including Food Service Establishments, shall be calculated at such rate set forth in Miami 21. Further, consistent with the express terms of Sec. 35-224.(4), Code, Developer shall be granted credit for buildings built prior to 1960 demolished to facilitate the Project. Such credit shall be calculated based on the square footage and existing Use(s) for the Building(s) being demolished or at the rate of 2 spaces per each existing off-street parking space on the Property subject to demolition, whichever credit proves greatest. Section 9. Public Facilities. As of the Effective Date, Developer has conducted an analysis of the Public Facilities available to serve the Project. In the event that the Existing Zoning and/or the Comprehensive Plan require Developer to provide Public Facilities to address any deficiencies in required levels of service occasioned solely by future development on the Property, Developer shall provide such Public Facilities consistent with the timing requirements of s. 163.3180, Fla. Stat. (2025), or as otherwise required by Chapter 13, Code, if applicable. Developer shall be bound by the City impact fees and assessments in existence as of the Effective Date of this Agreement. See Section 11 regarding Public Improvements. Section 10. Project Approval. (a) Future Development Review. Future development on Property shall proceed pursuant to and in accordance with the processes and standards established in the Miami 21 Code and the City Code. (b) Prohibition on Downzoning. The Comprehensive Plan, the Existing Zoning, and this Agreement shall govern the development of the Property for the duration of this Agreement. The City's laws and policies adopted after the Effective Date may be applied to the Property only if the determinations required by s. 163.3233.(2), Florida Statutes (2025), have been made following a public hearing or as otherwise provided herein. ii. Pursuant to s. 163.3233.(3), Florida Statutes (2025), this prohibition on downsizing supplements, rather than supplants, any rights that may vest to Developer under Florida or Federal law. As a result, Developer may challenge any subsequently adopted changes to the land development regulations based on (a) common law principles including, but not limited to equitable estoppel and vested rights, or (b) statutory rights which may accrue by virtue of Chapter 70, Florida Statutes (2025). Section 11. Public Improvements. In order to foster an enhanced aesthetic and quality of life enhancements in the area surrounding the Project, Developer, for it and the City's mutual benefit, has agreed to assume responsibility for the design and construction of the Public Improvements with said improvements to be financed with contributions by the City and Developer in accordance with the terms herein. (a) City Park Improvements. Developer has proposed a series of enhancements to the public park, which include, but are not limited to, the following: (i) resurfacing, 6 striping, and fencing of public tennis courts; (ii) reconstruction of the hitting wall; (iii) exterior improvements to the existing tennis center building; (iv) construction of a new children s play area; (v) construction of new concession building; and (vi) improvements to public spaces, including: installation and replacement of turf; installation of wood decking below banyan tree in southeast corner of the park; landscaping and installation of water features throughout park; and (vii) installation of decorative perimeter fencing (collectively, the "Park Improvements"). Developer's conceptual plan for the park improvements is attached hereto as Exhibit B. Developer shall work with resident stakeholders and organizations to finalize a design for the Kirk Munroe Park portion of Public Improvements, which final design plan shall be approved by the City Commission. Fuller Street Improvements. Developer has proposed a series of improvements to the Fuller Street between Main Highway and Grand Avenue, which include, but are not limited to, the following: (i) installation of decorative pavers; (ii) landscaping; (iii) specimen trees; (iv) signage; and (v) other decorative elements. Developer's conceptual plan for the park improvements is attached hereto as Exhibit C. Developer shall work with the BID, local business owners, and resident stakeholders to finalize the design for the Fuller Street portion of the Public Improvements, which final design shall be approved by both the BID and City Commission. Financing of Public Improvements. Developer and City have agreed to jointly underwrite the cost of Public Improvements. The Parties estimate the total cost of the Public Improvements at Five Million and 00/100 Dollars ($5,000,000.00) (the "Public Improvements Cost Estimate") with the City contribution of Three Million 00/100 Dollars ($3,000,000.00) (hereinafter, the "City Contribution") and a Two Million and 00/100 Dollars ($2,000,000.00) contribution by the Developer (hereinafter, the "Developer Contribution") (collectively, the "Public Improvements Contribution"). Following completion of the design and permitting of the Public Improvements, Developer shall present to City a revised Public Improvements Cost Estimate (the "Revised Public Improvements Cost Estimate"). Should the Revised Public Improvements Cost Estimate exceed the Public Improvements Cost Estimate, the Parties shall underwrite the difference in their proportionate share, which additional City contribution shall be subject to appropriation of available funds by the City Commission. In the event the City is unwilling or unable to fund their proportionate share of the difference between the Revised Public Improvements Cost Estimate and the Public Improvements Coste Estimate, Developer shall first prioritize the use of the Public Improvements Contribution towards the completion of the City Park Improvements. Should the City Commission agree to appropriate its proportionate share of the difference between the Revised Public Improvements Cost Estimate and the Public Improvements Cost Estimate, Developer shall agree to underwrite any costs in excess of the Revised Public Improvements Cost Estimate. Competitive Solicitations for Design and Construction of Public Improvements. Pursuant to the terms of Sec. 287.055(2)(b), Florida Statutes (2025), known as the Competitive Consultants Negotiation Act ("CCNA"), the term "Agency" does not extend to a non -governmental developer that contributes public facilities to a political (e) (f) Section 12. (a) subdivision under the Florida Local Government Development Agreement Act. Additionally, in no event shall any portion of the City Contribution be utilized in connection with the purchase of services contemplated under the CCNA. Accordingly, design services provided in connection with the design of the Public Improvements shall not be subject to the CCNA. Any expenditures incurred by the Developer in connection with the design of the Public Improvements shall be credited against the total amount of the Developer Contribution. Further, construction of the Public Improvements by Developer has been authorized pursuant to the requirements of Sec. 255.20(c)(10), Florida Statutes (2025). Through its adoption of this Agreement, but subject to the City Commission's adoption of the concurrent resolution authorizing the Development Management Agreement, as such term is defined below, with regard to the construction of the Public Improvements, the City Commission, by a vote of a two-thirds majority, has determined that it is in the best interest of City award the Project to Developer who has engaged the services of a licensed contractor to complete the work. Development Management Agreement. The design and construction of the Public Improvements shall be governed by the terms of a development management agreement (the "Development Management Agreement"). Upon the adoption of this Agreement, the City Manager is authorized to negotiate and execute a Development Management Agreement consistent with the form attached in Exhibit D and in a final form acceptable to the City Attorney. In the event the Public Improvements are not completed at the time Developer applies for a Certificate of Use for Developer's Project on the Property, Developer shall prior to the issuance of requested Certificate of Use for the Project provide a cash bond to the City in an amount equivalent to the unexpended portion of the Developer Contribution. Local Development Permits. Development of the Property in accordance to Miami 21 and Code is contemplated by Developer. Redevelopment of the Property may require additional permits or approvals from the City, Miami -Dade County, State or Federal government and any division thereof. Subject to required legal process and approvals, the City shall make a good faith effort to take all responsible steps to cooperate with and facilitate all such approvals. Such approvals include, without limitation, the following approvals and permits and any successor or analogous approvals and permits; i. Subdivision plat or waiver of plat approvals; ii. Covenant, unity of title, or covenant -in -lieu of unity of title acceptance or the release of existing unities or covenants; iii. Building permits; iv. Certificates of use and/or occupancy; 8 (b) v. Stormwater permits; and vi. Any other official action of the City, Miami -Dade County, or/and other government agency having the effect of permitting development of the Property. In the event the City substantially modifies its land development regulations regarding site plan approval procedures, authority to approve any plans, buildings, or development on the Property shall be vested solely in the City Manager, with the recommendation of the Planning Director or any other relevant party. Any such site plan shall be approved if it meets the requirements and criteria of the Existing Zoning, the Comprehensive Plan, and the terms of this Agreement. Section 13. Necessity of Complying with Local Regulations Relative to Development Permits. The Parties agree that failure of this Agreement to address a particular permit, condition, fee, term, license, or restriction in effect on the Effective Date shall not relieve Developer of the necessity of complying with the regulation governing said permitting requirements, conditions, fees, terms, licenses, or restrictions. Section 14. (a) (b) (c) Reservation of Development Rights. For the term of this Agreement, the City hereby agrees that it shall permit the development of the Property in accordance with the Existing Zoning, the Comprehensive Plan, and this Agreement. Nothing herein shall prohibit an increase in the density or intensity of development permitted at the Property in a manner consistent with (i) the Existing Zoning and/or the Comprehensive Plan; (ii) any zoning change or other entitlement process subsequently requested or initiated by Developer in accordance with applicable provisions of law; or (iii) any zoning change subsequently enacted by the City. The expiration or termination of this Agreement shall not be considered a waiver of, or limitation upon, the rights, including, but not limited to, any claims of vested rights, or equitable estoppel regarding claims arising during the term of this Agreement; and Developer or its successor or assigns may continue development of the Property in conformity with all active development permits or development orders granted by the City. Section 15. Annual Review. (a) This Agreement shall be reviewed by the City once every 12 months, commencing 12 months after the Effective Date during the Term of this Agreement. The Owner, or Developer, shall submit an annual report to the City not later than 30 days following the anniversary date of the Agreement. The annual report shall contain a section by section description of Owner's, or Developer's, compliance with any obligations under this Agreement. 9 (b) (c) Any information required of Developer during an annual review shall be limited to that necessary to determine the extent to which the Developer is proceeding in good faith to comply with the terms of this Agreement. If the City finds on the basis of competent substantial evidence that Developer has not proceeded in good faith to comply with the terms of the Agreement, the City may terminate or amend this Agreement after providing thirty (30) days written notice to the Developer and following a public hearing held before the City Commission. Section 16. Notices. (a) All notices, demands and requests which may or are required to be given hereunder shall, except as otherwise expressly provided, be in writing and delivered by personal service or sent by United States Registered or Certified Mail, return receipt requested, postage prepaid, or by overnight express delivery, such as Federal Express, to the parties at the addresses listed below. Any notice given pursuant to this Agreement shall be deemed given when received. Any actions required to be taken hereunder which fall on Saturday, Sunday, or United States legal holidays shall be deemed to be performed timely when taken on the succeeding day thereafter which shall not be a Saturday, Sunday or legal holiday. (b) To the City: With a copy to: To Developer: City Manager City of Miami 3500 Pan American Drive Miami, FL 33133 City Attorney City of Miami Miami Riverside Center 444 S.W. 2nd Avenue, 9th Floor Miami, FL 33130 Planning & Zoning Director City of Miami Miami Riverside Center 444 S.W. 2nd Avenue, 9th Floor Miami, FL 33130 Coconut Grove Condo, LLC c/o The Allen Morris Company 121 Alhambra Plaza, Ste. 1600 Coral Gables, FL 33134 Any party to this Agreement may change its notification address(es) by providing written notification to the other party pursuant to the terms and conditions of this 10 section. Section 17. Exclusive Venue, Choice of Law, Specific Performance. It is mutually understood and agreed by the Parties that this Agreement shall be governed by the laws of the State of Florida, and any applicable federal law, both as to the interpretation and performance, and that any action at law, suit in equity or judicial proceedings for the enforcement of this Agreement or any provision hereof shall be instituted only in the courts of the State of Florida or federal courts and venue for any such actions shall lie exclusively in a court of competent jurisdiction in Miami -Dade County. In addition to other legal rights, the Parties shall each have the right to specific performance of this Agreement in court. Each party shall bear its own attorney's fees. Each party waives any defense, whether asserted by motion or pleading, that the aforementioned courts are an improper or inconvenient venue. Moreover, the parties consent to the personal jurisdiction of the aforementioned courts and irrevocably waive any objections to said jurisdiction. The parties irrevocably waive any rights to a jury trial. Section 18. Authorization to Withhold Permits and Inspections. In the event the Developer is obligated to make payments or improvements under the terms of this Agreement or to take or refrain from taking any other action under this Agreement and such obligations are not performed prior to the expiration of any applicable notice and/or cure period, in addition to any other remedies available, the City is hereby authorized to withhold any further permits for the Property and refuse any inspections or grant any approvals with regard to any portion of the Property until such time this Agreement is complied with. This remedy shall be in addition to any other remedy provided for in this Agreement. Section 19. Voluntary Compliance. The Parties agree that in the event all or any part of this Agreement is struck down by judicial proceeding or preempted by legislative action, the Parties shall continue to honor the terms and conditions of this Agreement to the extent allowed by law. Section 20. No Oral Change or Termination. This Agreement and the exhibits and appendices appended hereto and incorporated herein by reference, if any, constitute the entire Agreement between the Parties with respect to the subject matter hereof. This Agreement supersedes any prior agreements or understandings between the Parties with respect to the subject matter hereof, and no change, modification, or discharge hereof in whole or in part shall be effective unless such complies with Florida Statutes and is in writing and signed by the party against whom enforcement of the change, modification or discharge is sought. This Agreement cannot be changed or terminated orally. Section 21. Compliance with Applicable Law. Subject to the terms and conditions of this Agreement, throughout the term of this Agreement, the Parties shall comply with all applicable federal, state, or local laws, regulations, codes, ordinances, resolutions, administrative orders, permits, policies and procedures and orders that govern or relate to the respective Party's obligations and performance under this Agreement, all as they may be amended from time to time. Section 22. Representations; Representatives. Each party represents to the others that this Agreement has been duly authorized, delivered and executed by such party and constitutes the legal, valid and binding obligations of such party, enforceable in accordance with its terms. Section 23. No Exclusive Remedies. No remedy or lection given by any provision in this Agreement shall be deemed exclusive unless expressly so indicated. Wherever possible, the remedies granted hereunder upon a default of the other party shall be cumulative and in addition to all other remedies of 11 law or equity arising from such event of default, except where otherwise expressly provided. Section 24. Failure to Exercise Rights not a Waiver; Waiver Provisions. The failure by either party to promptly exercise any right arising hereunder shall not constitute a waiver of such right unless otherwise expressly provided herein. No waiver or breach of any provision of this Agreement shall constitute a waiver of any subsequent breach of the same or any other provision hereof, and no waiver shall be effective unless made in writing. Section 25. (a) (b) (c) Events of Default. Developer shall be in default under this Agreement if Developer fails to perform or breaches any term(s), covenant(s), or condition(s) of this Agreement which is not cured within thirty (30) days after receipt of written notice from the City specifying the nature of such breach; provided, however, that if such breach cannot be reasonably cured within thirty (30) days, then Developer shall not be in default if it commences to cure such breach within thirty (30) days and diligently prosecutes such cure to completion. The City shall be in default under this Agreement if the City fails to perform or breaches any term, covenant, or condition of this Agreement and such failure is not cured within thirty (30) days after receipt of written notice from Developer specifying the nature of such breach; provided, however, that if such breach cannot be reasonably cured within thirty (30) days, then City shall not be in default if it commences to cure such breach within thirty (30) days and diligently prosecutes such cure to completion. It shall not be a default under this Agreement if either party is declared bankrupt by a court of competent jurisdiction. All rights and obligations in this Agreement shall survive such bankruptcy of either party. The Parties hereby forfeit any right to terminate this Agreement upon the bankruptcy of the other party. (d) The default of a successor or assignee of any portion of Developer's rights hereunder shall not be deemed a breach by Developer. Section 26. Remedies Upon Default. (a) (b) Neither party may terminate this Agreement upon the default of the other party, except as provided otherwise in this Agreement, including but not limited to in Section 16(c) of this Agreement, but shall have all of the remedies enumerated herein. Upon the occurrence of a default by a party to this Agreement not cured within the applicable grace period, Developer and the City agree that any party may seek specific performance of this Agreement, and that seeking specific performance shall not waive any right of such party to also seek monetary damages, injunctive relief, or any other relief other than termination of this Agreement. Section 27. Severability. If any term or provision of this Agreement or the application thereof, shall to any extent, hereafter be determined to be invalid or unenforceable, the remainder of this Agreement or the application other than those as to which it is held invalid or unenforceable shall not be affected thereby and shall continue in full force and effect. 12 Section 28. Assignment & Transfer. This Agreement shall be binding on Developer and its heirs, successors and assigns, including the successor to or assignee of any Property interest. Developer, in its sole discretion, may assign, in whole or in part, this Agreement or any of its rights and obligations hereunder, or may extend the benefits of this Agreement, to any holder of a property interest without the prior written consent of, or any other approval of, the City. Notice of any assignment or transfer shall be provided to the City in accordance with the requirements of Section 17. Any such assignee shall, be in writing in a form acceptable to the City Attorney, assume all applicable rights and obligations under this Agreement, and upon such assumption, the assigning party shall be released from all obligations assumed by such assignee. Section 29. Obligations Surviving Termination Hereof. Notwithstanding and prevailing over any term or provision to the contrary contained herein, in the event of any lawful termination of this Agreement, the following obligations shall survive such termination and continue in full force and effect until the expiration of a one-year term following the earlier of the effective date of such termination or the expiration of the Term: (i) the exclusive venue and choice of law provisions contained herein; (ii) rights of any party arising during or attributable to the period prior to expiration or earlier termination of this Agreement; (iii) the indemnification provision; and (iv) any other term or provision herein which expressly indicates either that it survives the termination or expiration hereof or is or may be applicable or effective beyond the expiration or permitted early termination hereof. Section 30. Lack of Agency Relationship. Nothing contained herein shall be construed as establishing an agency relationship between the City and Developer and neither Developer or its employees, agents, contradors, subsidiaries, divisions, affiliates, or guests shall be deemed agents, instrumentalities, employees, or contractors of the City for any purpose hereunder, and the City, its contradors, agents, and employees shall not be deemed contractors, agents, or employees of Developer or their subsidiaries, divisions, or affiliates. Section 31. Cooperation; Expedited Permitting; Time of the Essence. (a) The Parties agree to cooperate with each other to the full extent practicable pursuant to the terms and conditions of this Agreement. The Parties agree that time is of the essence in all aspects of their respective and mutual responsibilities pursuant to this Agreement. The City shall reasonably cooperate to expedite the permitting and approvals in an effort to assist Developer in achieving its development and construction milestones. The City will accommodate requests from Developer's general contractor and subcontractors for review of phased or multiple permitting packages, such as those for excavation, site work and foundations, building shell, core, and interiors. In addition, the City will designate an individual within the City Manager's office who will have a primary (though not exclusive) duty to serve as the City's point of contact and liaison with Developer in order to expedite the processing and issuance of all permit and license applications and approvals across the various departments and offices of the City which have the authority or right to review and approve all applications for such permits and licenses. (b) Notwithstanding the foregoing, the City shall not be obligated to issue development permits to the extent that Developer does not comply with the applicable requirements of the Existing Zoning, the Comprehensive Plan, this Agreement, and the applicable building codes or regulations. 13 Section 32. Enforcement. (a) If Developer, or its successors or assigns, fails to act in accordance with the terms of the Existing Zoning or this Agreement, the City shall seek enforcement of said violation upon the subject Property. (b) Enforcement of this Agreement shall be by action against any parties or persons violating, or attempting to violate, any covenants set forth in this Agreement. Each Party shall bear their own attorneys' fees and costs. (c) This enforcement provisions shall be in addition to any other remedies available at law, in equity or both. Section 33. Amendment or Termination by Mutual Consent. This Agreement may not be amended or terminated during its term except by mutual, written agreement of Developer and the City, except as provided otherwise in this Agreement, including but not limited to Section 16(c). Prior to any amendment or termination of this Agreement during its term, the City shall hold two (2) public hearings to consider and deliberate such amendment or termination. Section 34. Third Party Defense. Developer agrees to indemnify and defend the City from and against any and all claims, suits, appeals, demand, liabilities, and causes of action of any nature by or on behalf of any person, firm or corporation, against the City relating to or arising from this Agreement or relating to or arising from any Development on the Property pursuant to this Agreement and from and against all costs, fees, expenses, liabilities, any orders, judgments, or decrees which may be entered and from and against all costs for attorneys fees, expenses, and liabilities incurred in the defense of such claim or in the investigation thereof. This includes, without limitation, a (i) consistency challenge pursuant to s. 163.3215, Florida Statutes (2025); (ii) petition for writ of certiorari; (iii) an action for declaratory judgment; or (iv) any claims for loss, damage, liability, or expense (including reasonable attorneys' fees). In the event that any action or proceeding is brought against the City by reason of a claim, Developer, upon notice from the City, shall, at its expense, defend the action or proceeding by counsel chosen by the City and approved by the Developer, including the City Attorney's office or outside counsel. The City retains the right to make all decisions with respect to its representations in any legal proceeding, including its inherent right to abandon or settle litigation. Section 35. No Conflict of Interest. Developer agrees to comply with Section 2-612, Code, as of the Effective Date, with respect to conflicts of interest. Section 36. No Third -Party Beneficiary. No persons or entities other than Developer and the City, their heirs, successors and assigns, shall have any rights whatsoever under this Agreement. Section 37. Counterparts. This Agreement may be executed in two (2) or more counterparts, each of which shall constitute an original but all of which, when taken together shall constitute one and the same agreement. The Parties shall be entitled to sign and transmit an electronic signature of this Agreement (whether by facsimile, PDF or other email transmission), which signature shall be binding on the party whose name is contained therein. Any party providing an electronic signature agrees to promptly execute and deliver to the other parties an original signed Agreement upon request. 14 NOW, WHEREOF, the City and the Developer have caused this Agreement to be duly executed, [Signature Pages to Follow] IN WITNESS hereof the parties have cause this Agreement to be duly entered into and signed as of the date written above, Witnesses: Print Name: A\Wt ow STATE OF FLORIDA MIAMI-DADE COUNTY ) ) COCONUT GROVE CONDO, LLC, a Delaware Iimited liability company By: Print Name: Yacrnin Gil Title: Manager The foregoing instrument was acknowledged before me this5 day of 064 20 , 00 ___ by Ya . ' is Manager of Coconut Grove Condo, LLC, a Delaware limited liability company, who is o me or who produced as identification. My commission expires: • 4 ' REVETAL ATTIAS ;f \ ;`; Notary Public • State of Florida oFl...Commission My Comm.Comm.Exp€ es Oct 23, 2028 1 Bonded through National Notary Assn. 1 NOTA Y PUBLIC, State of Florida 15 IN WITNESS hereof the parties have caused this Agreement to be duly entered into and signed as of the date written above. ATTEST: Todd Hannon, City Clerk APPROVED BY THE PLANNING DEPARTMENTAS TO CONTENT: David Snow, Planning Director APPROVED AS TO LEGAL FORM AND CORRECTNESS: George K. Wysong III, City Attorney 16 CITY OF MIAMI, a municipal corporation located within the State of Florida By: Print Name: Arthur Noriega, V Title: City Manager OWNER JOINDER 3101 GROVE TRUSTEE, LLC, a Delaware limited liability company, whose mailing address is 121 Alhambra Plaza, PHI, Coral Gables, Florida 33134 ("Owner"), which is the owner of the following described property(ies)(the "Company"): Lot 1, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida, Less the East five (5) feet and North five (5) feet of Lot 1, Block 2, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida, as conveyed by Warranty Deed recorded in Deed Book 3791, Page 226, re -recorded in Official Records Book 5018, Page 116, of the Public Records of Miami -Dade County, Florida. Also known as: 3100 Florida Avenue (Folio No, 01-4121-032-0118) Hereby agrees to join in the Agreement. WITNESSES: Printed Name: ncvti n, •_ t }.t\ Printed Nan e: PR - OWNER: 3101 GROVE TRUSTEE, LLC, a Delaware limited company By: Y f' Gil Its: • /utlorized Representative The foregoing instrument was acknowledged before me this 25 day of /2 2025, by Yazmin Gil, as Aut Representative of 3101 GROVE TRUSTEE, LLC, a Florida limited liability company, wh o me, or has produced as identification. r""'i� ••, REVETAL ATCIAS Rf Notary Public • State of Florida Commission R HH 605673 My Comm. Expires Oct 23, 2028 Bonded through National Notary Assn. 19 Printed Name: vr--I j 2 ( Notary Public My Commission Expires: ID /Z3f Z$ OWNER JOINDER AYME PROPERTIES, LLC, a Florida limited liability company, whose mailing address is 8325 SW 54th Avenue, Miami, FL 33143 ("Owner"), which is the owner of the following described property(ies) (the "AYME Properties"): Tracts "A" and "B" of HAAS PROPERTIES, according to the Plat thereof, recorded in Plat Book 51, at Page 65 of the Public Records of Miami -Dade County, Florida. Also known as: 3101 & 3131 Grand Avenue, Miami, FL (Folio No. 01-4121-030-0020 & 01-4121- 030-0010) Hereby agrees to join in the Agreement. WITNESSES: Printed Name: Re. rJ C . `are ‘-)4:14 A. Printed Name: . ,` A. ikrlfr 4. The foregoing instrument was acknowledged before me this.'$fhday oft e' 2025, by & vile 4 Csccno ct, as Manager Member of AYME PROPERTIES, LLC, a Florida limited liability company, who is personally known to me, or has produced OWNER: AYME PROPERTIES, LLC, a Florida limited company l.'o VICTOR PARIONA �:Notary Public -State of Florida '� Commission Ht! 893604 ' I I "9 My Commission Expires June 30, 2029 17 By: Its: Cristina Espinosa Manager Member as identification. Printed NET;- � hC-'%( ?arioAA. Notary Public My Commission Expires: Jufl€' '9, 2026‘ OWNER JOINDER AYME FLORIDA AVENUE PROPERTIES, LLC, a Florida limited liability company, whose mailing address is 8325 SW 54th Avenue, Miami, FL 33143 ("Owner"), which is the owner of the following described property(ies)(the "AYME Florida"): Lot 2, 3, 4, 5 & 6, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Also known as: 3104, 3114, 3124, 3150 & 3158 Florida Avenue (Folio No. 01-4121-032-0120, 01-4121-032-0130,01-4121-032-0140,01-4121-032-0150 & 01-4121-032-0160) Hereby agrees to join in the Agreement. WITNESSES: Printed Name: Q �t ‘)60446 Printed Name: `//,I "Qv '$, A. The foregoing instrument was acknowledged before me this 2441 day of Ot#yber, 2025, by cfl5( inet Gee o , as Manager Member of AYME FLORIDA AVENUE PROPERTIES, LLC, a Florida limited liability company, who is personally known to me, or has produced as identification. Wei an, OWNER: AYME FLORIDA AVENUE PROPERTIES, LLC, a Florida lim eyi company .�`',1IN, VICTOR PARIONA . Notary Public -State of Florida Commission # HH 693604 .r:. My Commission Expires u„a• June 30, 2029 18 By: Chia E nosa Its: Manager Member Yc * r alv- (.1i'10k ublic My Commission Expires: ,3Vhd-30i 2-02' Printed Notary EXHIBIT A OWNERS PROPERTY DESCRIPTION 20 Address: 3101 Grand Avenue, Miami, FL Folio No.: 01-4121-030-0020 Owner: AYME Properties, LLC Legal Description: Tract "B" of HAAS PROPERTIES, according to the Plat thereof, recorded in Plat Book 51, at Page 65 of the Public Records of Miami -Dade County, Florida. Address: 3101 Grand Avenue, Miami, FL Folio No.: 01-4121-030-0010 Owner: AYME Properties, LLC Legal Description: Tract "A" of HAAS PROPERTIES, according to the Plat thereof, recorded in Plat Book 51, at Page 65 of the Public Records of Miami -Dade County, Florida. Address: 3100 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0118 Owner: 3101 Grove Trustee, LLC Legal Description: Lot 1, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. LESS the East five (5) feet and North five (5) feet of Lot 1, Block 2, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami - Dade County, Florida, as conveyed by Warranty Deed recorded in Deed Book 3791, Page 226, re -recorded in Official Records Book 5018, Page 116 of the Public Records of Miami -Dade County, Florida. Address: 3104 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0120 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 2, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3114 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0130 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 3, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. 21 Address: 3124 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0140 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 4, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3150 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0150 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 5, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3158 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0160 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 6, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. 22 EXHIBIT B CONCEPTUAL PARK PLANS 23 EXHIBIT C CONCEPTUAL FULLER STREET IMPROVEMENTS 24 EXHIBIT D DEVELOPMENT MANAGEMENT AGREEMENT 25 THIS DEVELOPMENT MANAGEMENT AGREEMENT (hereinafter, the "Agreement"), made and entered into this _ day of , 2025 by and between the CITY OF MIAMI, FLORIDA, a Florida municipal corporation (hereinafter, the "City"), and COCONUT GROVE CONDO, LLC, a Delaware limited liability company doing business in the State of Florida, (hereinafter, "Development Manager" or "AMCO"). WITNESSETH: WHEREAS, the City desires to enter into an Agreement for the enhancements to portions of Kirk Munroe Park and portions of the public rights -of -way along Grand and Oak Avenues and Matilda and Fuller Streets located in the Coconut Grove neighborhood (the "Project"), and WHEREAS, Development Manager is the sponsor of a mixed -use condominium project, comprised of retail, office and residential condominium uses, located on an assemblage bounded by Grand Avenue to the South, Oak Avenue to the North, and Matilda Street to the East, and immediately South of Kirk Munroe Park (the "AMCO Grove Project"), which Development Manager intends to construct concurrently with the Projed; and WHEREAS, Development Manager represents that it possesses the requisite expertise and desires to enter into an Agreement to act as the development manager to provide the services as set forth herein; and WHEREAS, this Agreement serves a municipal purpose and primarily effectuates a public purpose furthering the general health, safety and welfare of the City as it enhances, improves and embellishes the public infrastructure and rights -of -way, and thoroughfares in the "Coconut Grove" area of the City which has undergone a recent renaissance and become one of South Florida's premiere "Live, Work, Play" communities for both residents and visitors alike; and WHEREAS, pursuant to Resolution No. - , passed on , 202 , the City Commission allocated the required $3,000,000.00 (the "City Contribution") match to secure the match offered by the Development Manager in the amount of $2,000,000.00 (the "Development Manager Contribution"); and WHEREAS, this Agreement implements the expenditure of a sum not to exceed the amount of the City Contribution to be expended solely on work comprising part of the Project which money is a not a charge against the general funds or accounts of the City but is limited to the amount of the City Contribution as a match to Development Manager Contribution, which Development Manager Contribution is contingent upon the City's provision of the City Contribution, which funding has been allocated solely from the City's Capital Improvements Program ("CIP") No. B- to underwrite the costs of the Projed within the Coconut Grove district; and WHEREAS, Development Manager has agreed to retain a qualified general contractor ("Contractor") to perform the scope of work comprising the Projed, as described herein below, within the available funds and cover the costs of any funding shortfalls to complete the desired improvements; and WHEREAS, the City Commission has authorized the City Manager to execute and enter into this Agreement by its adoption of Resolution No. 25- on , 2025; 26 NOW THEREFORE, in consideration of the mutual covenants set forth herein the City and Development Manager, agree as follows: SECTION 1- TERMS AND CONDITIONS 1. INCORPORATION BY REFERENCE; OVERVIEW The foregoing recitals, the Exhibits to this Agreement, and the prior Agreements, ordinances and resolutions referenced in this Agreement are all deemed as being incorporated by reference herein as if set forth in full in this Section of the Agreement. This Agreement covers the services of Development Manager for the design, permitting, construction, and installation of improvements to: (i) the City -owned park located at 3120 and 3152 Oak Avenue, Miami, Florida 33133 ("Kirk Munroe Park"); (ii) portions of Grand Avenue, Oak Avenue, and Matilda Street adjoining the AMCO Grove Project; and (iii) the portions of Fuller Street located between Grand Avenue and Main Highway (the "Project"). The Work under this Agreement will be solely performed over areas which are owned by a public agency (e.g. City, County or State). No work under this Agreement will be performed on privately owned property. A conceptual description and depiction of the Project is more fully described in the plans and specifications included in Attachment "A" (the "Conceptual Project Plans"). The Development Manager, through an Architect/Engineer retained by the Development Manager, shall develop and permit final design plans for the improvements comprising the Project which are consistent with the Conceptual Project Plans (the "Project Plans"). The Project Plans shall be approved by the City Manager, which approval shall not be unreasonably withheld, conditioned or delayed. 2. INTENTION OF CITY It is the intent of City to have the Project constructed in accordance with the Conceptual Project Plans and in accordance with all codes and regulations governing construction of the Project. Any work, materials or equipment that may reasonably be inferred from the Project Plans as being required to produce the intended result shall be supplied by Development Manager, through its Contractor, whether or not specifically called for. When words, which have a well-known technical or trade meaning, are used to describe work, materials or equipment, such words shall be interpreted in accordance with that meaning. Reference to standard specifications, manuals, or codes of any technical society, organization or association, or to the laws or regulations of any governmental authority, whether such reference be specific or by implication, shall mean the latest standard specification, manual, code or laws or regulations in effect at the time of contract approval and Development Manager shall require that Contractor comply therewith. City shall have no duties other than those duties and obligations expressly set forth herein. 3. DEFINITIONS i. "AMCO Grove Project" refers to the a mixed -use office and residential condominium project proposed to be developed on an land assemblage totaling approximately 1.66 acres +/- bounded by Grand Avenue on the South, Matilda Street on the East, and Florida Avenue on the North totaling and having a principal address of 3101 Grand Avenue, Miami, Florida. ii. "Architect/Engineer" means the Architectural and/or Engineering firm(s) retained by the Development Manager for the preparation of the Project Plans in connection with the Project. Development Manager's selection of any of the following architectural or engineering firm shall be deemed approved by the City: La Casona Gardens Designs Corp.; Naturalficial, Inc.; 27 Oppenheim Architecture & Design, LLC; Arquitectonica; Arquitectonica GEO Corporation; Raymond Jungles, Inc.; Langan Engineering, Environmental, Surveying & Landscape Architecture, Design Professional Corporation; and Kimley Horn & Associates, Inc. The Architectural and/or Engineering firms are referred to herein as the "A/E." Any selection of an A/E firm not listed hereinabove shall be approved by the City Manager. iii. "City" means the City of Miami, Florida, a Florida municipal corporation. In all respects hereunder, City's performance is pursuant to the City's capacity as owner of the Project. In the event the City exercises its regulatory authority as a governmental body, the exercise of such regulatory authority and the enforcement of any rules, regulations, codes, laws and ordinances shall be deemed to have occurred pursuant to City's authority as a governmental body and shall not be attributable in any manner to the City as a party to this Agreement. For the purposes of this Agreement, "City" without modification shall mean the City Manager or Director, as applicable. iv. "City Commission" means the legislative body of the City of Miami. v. "City Contribution" means the Three Million and No/100 Dollars ($3,000,000.00) contribution provided by the City or agency of the City to underwrite a portion of the Project Cost. vi. "City Manager" means the duly appointed chief administrative officer of the City of Miami. vii. "Development Manager Contribution" means the Two Million and No/100 Dollar ($2,000,000.00) contribution provided by the Development Manager to underwrite a portion of the Project Cost. viii. "Conceptual Project Plans" means the preliminary design plans for the Project attached and made part of the Agreement and included in Exhibit A. ix. "Construction Change Directive" means a written directive to effect changes to the Project, prepared by the A/E and or Development Manager and executed by the City. x. "Contract Documents" means this the documents described in Section 1, Article 7 of this Agreement. xi. "Contractor" means the entity responsible, pursuant to its Construction Agreement with Development Manager or its related companies for performing the Construction Work and who is licensed, bonded, and insured to perform this Project in accordance with the terms of the Agreement(s) between the Development Manager or its affiliates and the Contractor. The Contractor under this Agreement shall be a licensed general contractor selected by the Development Manager. Development Manager intends to enlist the services of one of the following firms: (i) Coastal Construction Group of South Florida, Inc.; (ii) Brasfield & Gorrie, LLC; (iii) Juneau Construction Company, LLC; and (iv) VPI Builders;/ Veitia Padron Inc.. Selection of any of the aforementioned Contractors by Development Manager shall be deemed approved by the City. Selection of any Contractor other than those listed hereinabove shall be approved by the City Manager, which approval shall not be unreasonably withheld, conditioned or delayed. The Contractor's means and methods of construction shall be performed by it under applicable laws, rules, regulations, codes and construction practices. 28 xii. "Construction Work" means all of the construction elements of the Project required by this Agreement. xiii. "Contract Time" means the time period defined in this Agreement for the Development Manager to complete the Project. xiv. "Cure" means the action taken by the Development Manager, either directly or through its Contractor, promptly after receipt of written notice from the City of a breach of the Agreement for the Project, which shall be performed at no cost to the City, to repair, replace, correct, or remedy all material, equipment, or other elements of the Project or the Agreement affected by such breach, or to otherwise make good and eliminate such breach, including, without limitation, repairing, replacing or correcting any portion of the Project site disturbed in performing such cure. xv. "Cure Period" means the period of time in which the Development Manager is required to remedy deficiencies in the Work or compliance with the Contract Documents after receipt of written notice to Cure from the City identifying the deficiencies and the time to Cure. xvi. "Design Documents" means the construction plans and specification prepared by A/E(s) for this Project under separate agreement(s) with the Development Manager or Contractor, as applicable. xvii. "Development Manager" is the entity who provides development services for the City as Owner for the Design and Construction Phases of this Project covered by this Agreement. The Development Manager possesses the requisite training and experience to make decisions on behalf of the Owner and give advice on the time and cost consequences of design and construction decisions, scheduling, cost control, coordination of contract negotiations and awards, timely purchasing of critical materials and long -lead items, and coordination of development activities. The Development Manager under this Agreement is Coconut Grove Condo, LLC. The Development Manager is responsible for supervising and directing the Contractor for the work funded by this Agreement. Development Project Manager means the person designated by Development Manager as its lead representative to the City. The person is an agent of the Development Manager and his or her actions bind the Development Manager. The Development Manager shall have the authority to obligate and bind Development Manager and to ad on all matters on behalf of Development Manager except for revisions to the Contract Documents. The Development Manager shall mean Coconut Grove Condo, LLC. The failure of the Contractor, any Sub -Contractor, or any other third party to perform their obligations under agreements with the Development Manager or its affiliates, whether related to the Construction Work or otherwise connected to the Project, shall not relieve the Development Manager of its obligations set forth herein, including, without limitation, those obligations intended to be fulfilled through the services of such Contractor, Sub -Contractor, or third party. xviii. "Director" means the Director of the Office of Capital Improvements or his/her designee, who has the authority and responsibility for managing the Project under this Agreement. xix. "Drawings" means the graphic and pictorial portions of the Project Plans, which show the 29 design, location and dimensions of the Construction Work to be performed, including, without limitation, all notes, schedules and legends on such Drawings as prepared by the A/E(s) in Attachment "A". xx. "Excusable Delay" means any delay in the performance of the Work that is beyond the reasonable control of the Development Manager, which materially affects the progress of the Work, and which is not attributable to the fault, negligence, or breach of the Development Manager or its subcontractors. Excusable Delays include, but are not limited to: (i) differing site conditions or concealed physical conditions not reasonably foreseeable; (ii) unreasonable delay in the receipt of necessary permits, approvals, or inspections caused by governmental authorities (other than delays resulting from Development Manager's noncompliance or failure to timely submit required applications); and (iii) City -directed changes, suspensions, or delays in the Work; (iv) delay in City's delivery of information that City is obligated to provide. For clarity, Excusable Delays shall not include a Force Majeure Event. xxi. "Field Directive" means a written approval for the Development Manager to proceed with Work requested by the City or the A/E(s), which is minor in nature and should not involve additional cost. xxii. "Final Completion" means the date subsequent to the date of Substantial Completion at which time the Development Manager, through its Contractor, has completed all the Project in accordance with the Agreement as certified by the A/E or the City and submitted all documentation required by the Agreement. xxiii. "Final Design Plans" means the design plans for the Project developed by the A/E for the Development Manager and approved by the City. xxiv. "Force Majeure Event" means any event or circumstances beyond the reasonable control of the Development Manager or its subcontractors that prevents, delays, or materially delays impairs the performance of the Work under this Agreement, provided such event could not reasonably have been anticipated or avoided. Force Majeure Events include, but are not limited to: (i) Ads of God, such as earthquakes, floods, hurricanes, tornadoes, lightning, or other natural disasters; (ii) epidemics, pandemics, or public health emergencies (including governmental restrictions arising therefrom); (iii) ads of war, terrorism, civil commotion, or insurrection; (iv) unforeseen governmental actions, embargoes, orders, or changes in law or regulations; (v) strikes, lockouts, or other labor disputes not limited to Development Manager's own employees; and (vi) widespread shortages or unavailability of materials, equipment, energy, or transportation services due to causes beyond the Development Manager's control. For clarity, Force Majeure Events shall not include normal adverse weather conditions, delays caused solely by the negligence or fault of the Development Manager, or financial difficulties. xxv. "Guaranteed Maximum Cost" means the sum established in this Agreement and related documents as the maximum cost to the City for performance of all work pursuant to the terms of this Agreement. The guaranteed maximum cost of the Project is $5,000,000.00, which consists of the City Contribution referenced in the Whereas clauses and the Development Manager Contribution. The City shall not be liable for any reimbursable expenditure, cost, fee, charge, damage, expense, assessment or imposition relative to or arising by virtue of this Agreement beyond the amount of the City Contribution comprising its portion of the Guaranteed 30 Maximum Cost ("GMC"), which shall be the maximum cost to the City for performance of the Project. The City acknowledges that it may cost more to complete the Project. However, any excess cost over the GMC and not included in an approved Change Order or Construction Change Directive ("CCD") shall be paid for by the Development Manager or others. xxvi. "Notice To Proceed" means a written letter or directive issued by the Director or City's Project Manager acknowledging that all conditions precedent have been met and directing that the Development Manager, through its Contractor, may begin the Project or a specific task of the Project. xxvii. "Project" means the design, permitting, and installation of improvements to: (i) Kirk Munroe Park; (ii) portions of Grand Avenue, Matilda Street, and Florida Avenue adjoining the Coconut Grove Condo Project; and (iii) the portions of Fuller Street located between Grand Avenue and Main Highway specified in this Agreement as contemplated and budgeted by the City. xxviii. "Project Cost" means the total cost of the Work, which amount is estimated at Five Million and No/100 Dollars ($5,000,000.00). xxix. "Project Manager" means an employee or representative of the City assigned by the Director to monitor the Project to be performed under this Agreement and the design and construction of the Project which has not been delegated to the Development Manager. Notwithstanding any language contained herein to the contrary, in no event shall the City's Project Manager have any authority to modify the terms of this Agreement or otherwise waive the obligations of the Development Manager as set forth herein. xxx. "Project Plans" means the Final Design Plans and permitted plans for the improvements comprising the Project. xxxi. "Punch List" means a compilation of items of Construction Work required to be performed by, or through the Development Manager prior to or after the Substantial Completion inspection and prior to Final Completion and payment. xxxii. "Record Set" means the copy of the Drawings, Specifications, and other modifications of the Agreement to be maintained at the Project site by the Contractor, in good order and marked currently to record changes and shall include additions, revisions, modifications, change orders, approved substitutions, shop drawings and accurate dimensioned locations for items recorded, including but not limited to, all underground utilities. xxxiii. "Request For Information (RFI)" means a request from the Contractor seeking an interpretation or clarification by the A/E(s) relative to the Agreement and/or the Drawings. The RFI, which shall be clearly marked RFI, shall clearly and concisely set forth the issue(s) or item(s) requiring clarification or interpretation and why the response is needed. The RFI must forth the Contractor's interpretation or understanding of the document(s) in question, along with the reason for such understanding. xxxiv. "Risk Administrator" means the City's Risk Management Administrator, or designee, or the individual named by the City Manager to administer matters relating to insurance and risk of loss for the City. 31 xxxv. "Schedule of Values" means a written schedule setting forth the detailed and itemized cost breakdown, inclusive of labor, material, and taxes of all elements of the Project. The schedule (attached) shall be used to bill against monthly based on a percentage of completion. xxxvi. "Specifications" as used herein means the portion of the Contract Documents which are the written requirements for the materials, equipment, systems, standards and workmanship for completion of the Project and performance of related services. xxxvii. "Sub-Contractor(s)" means a person or entity other than material person or laborer that has a direct contract with the Contractor to perform or supply a portion of the Construction Work. xxxviii. "Submittals" mean documents prepared by the Development Manager, Contactor or those working on their behalf to show a particular aspect of the Construction Work is to be fabricated and installed. Such submittals include shop drawings, product data, samples, mark-ups, test results, warranties, maintenance agreements, Project photographs, record documents, field measurement data, operating and maintenance manuals, reports, certifications and any other information described in the Agreement. xxxix. "Substantial Completion" means that point at which the Construction Work is at a level of completion in substantial compliance with the Agreement such that the City and members of the general public can use, occupy, and/or operate the facility in all respects to its intended purpose. Substantial Compliance shall not be deemed to have occurred until any and all governmental entities, which regulate or have jurisdiction over the Project, have inspected, and approved the Project. xl. "Work" as used herein refers to all pre -construction, construction and other services required by the Contract Documents, including all labor, materials, equipment, procurement and services needed to complete the Project. 4. SCOPE OF WORK Development Manager, either itself or through its Contractor, shall provide all management, supervision, manpower, equipment, tools, and all other necessary goods and services for the Project as detailed in the attached specifications, drawings and plans as contained in Attachment "A," and in accordance with the Contract Documents. 5. FINAL DESIGN PLAN DEVELOPMENT It is the express intent of the City and Development Manager that the Final Design Plan be developed in consultation with neighborhood stakeholders. The City and Development Manager shall meet with such neighborhood stakeholders identified by the District 2 City Commissioner, including, but not limited to, the Coconut Grove Business Improvement District, the Parent-Teacher Association for Coconut Grove Elementary School, and business and property owners abutting the portions of the right- of-way comprising part of the Project, to discuss the various elements of the Project and solicit their preferences/feedback. The Final Design Plan shall be presented to the City Commission for approval not later than 180 days following execution of this Agreement, unless that date is further extended at the sole discretion of the City Manager upon written request for such an extension from the Development Manager 32 or District 2 City Commissioner. 6. CONTRACT VALUE AND PROTECT COST The Development Manager shall comply with the terms of this Agreement for no compensation. Payments shall be made for elements of the Projed performed and accepted by the City. Total cost to complete the Project is estimated equal to the Project Cost. The Development Manager shall cover or ensure that others cover any and all cost overruns necessary to complete the Project in excess of the City Contribution. 6. TIME IS OF THE ESSENCE; TIME FOR COMPLETION; TERM Time is of the essence in the performance of this Agreement. Development Manager, either itself or through its Contractor, will promptly perform its duties under the Contract Documents and will give the completion of the Projed as much priority as is necessary to cause the Project to be completed in a timely basis in accordance with the Contract Documents. Development Manager shall ensure that all elements of the Project under this Agreement are substantially completed, as evidenced by certificate of occupancy or completion for the by not later than seven (7) years from the date of City Commission approval on , 202_ ("Completion Date"). The term of this Agreement shall extend one (1) year past the Completion Date. 7. CONTRACT DOCUMENTS The Contract Documents shall consist of this Agreement, and to the extent duly approved, the Drawings and Specifications, approved written interpretations and clarifications, Field Directives, Construction Change Directives, and any modifications. Any modification to this Agreement shall only be effective if it is reduced to writing, and duly executed by both parties, except a Field Directive or Constructive Change Directive shall be effective after approval and execution by Director or designee. The general intent of the Contract Documents is to include all items necessary for the proper execution and completion of the Project by the Development Manager and its Contractor. 8. PRIORITY OF PROVISIONS If there is a conflict or inconsistency between any term, statement requirement, or provision of any exhibit attached hereto, any document or events referred to herein, or any document incorporated into this Agreement by reference and a term, statement, requirement, the specifications and plans prepared by the A/E, or provision of this Agreement the following order of precedence shall apply: In the event of conflicts in the Contract Documents the priorities stated below shall govern: • Approved revisions to the Contract Documents shall govern over the Contract Documents • No section of the specifications or plans shall govern over the Contract Terms and Conditions Project Plans and Specifications shall govern over plans and drawings. In the event of conflicts with the plans the priorities stated below shall govern: 33 • Schedules, when identified as such shall govern over all other portions of the plans • Specific notes shall govern over all other notes, and all other portions of the plans, unless specifically stated otherwise • Larger scale drawings shall govern over smaller scale drawings • Figured or numerical dimensions shall govern over dimensions obtained by scaling • Where provisions of codes, manufacturer's specifications or industry standards are in conflict, the more restrictive or higher quality shall govern In the event of omissions in the Contract Documents that are incidental detail(s) of construction or construction system(s) or with regard to the manner of combining or installing equipment, parts, or materials, such detail shall be deemed to be an implied requirement of the Contract Documents. The quality and quantity of the equipment, material, or part so furnished shall conform to trade standards and be compatible with the type, composition, strengths, size and profile of the equipment, materials or parts otherwise specified in the Contract Documents. 9. PAYMENT REQUESTS Development Manager may make application for payment for Construction Work completed during the Project at intervals of not more than once a -month (the "Application for Payment"). Development Manager's Application for Payment shall be accompanied by a conditional partial release of liens relative to the Construction Work, which is the subject of the Application for Payment and any other information reasonably required by the City. Each Application for Payment shall be submitted in triplicate to City's Project Manager for approval. City may withhold, in whole or in part, payment to such extent as may be necessary to protect itself from loss on account of: • Defective Construction Work not remedied. • Claims filed by other parties against Development Manager, Contractor or City because of Development Manager and/or Contractor's negligent performance of the Work. • Failure of Development Manager to make payments properly to its Contractor or Sub - Contractors or for material or labor arising out of the Work. • Failure of Development Manager to provide any and all documents required by the Contract Documents. 10. PAYMENT Payment by the City of an approved Application for Payment approved by the A/E shall be made within twenty-five (25) business days after receipt of Development Manager's Application for Payment to the City, which shall be accompanied by reasonably sufficient supporting documentation and contain 34 sufficient detail, to allow a proper audit of expenditures, should the City require one to be performed. All payment applications shall be sufficiently detailed so as to meet the definition of a "payment request" for construction services as said term is defined in §218.72, Fla Stat., the Definitions section of the "Local Government Prompt Payment Act." City acknowledges that payment will not be unreasonably withheld or delayed. No interest shall accrue on late payments. Development Manager acknowledges that the City Contribution represents sixty percent (60%) of the total Project funding, as reduced by the applicable design costs (the "City Contribution Percentage"). Payments made by the City in connection with each Application for Payment shall be for not more than the City Contribution Percentage of the amount of the Application for Payment request with the balance payable from the Development Manager Contribution. Notwithstanding any language contained in this Agreement to the contrary, in no event shall the City be required to pay any amount in excess of the City Contribution, unless an increase in the amount of the City Contribution is approved by the City Commission. 11. PROGRESS MEETINGS Development Manager and the City's Project Manager shall hold construction progress meetings as deemed necessary to ensure the timely completion of the Work, but not more often than once a month. 12. DEVELOPMENT MANAGER INDEMNITY Development Manager and Contractor, by contract or rider, addendum or amendment to its construction contract with Development Manager, shall jointly and severally indemnify, defend, save and hold harmless City, its officers, agents, directors, and employees, from liabilities, damages, losses, and costs, including, but not limited to reasonable attorney's fees, and costs to the extent caused by the negligence, recklessness or intentional wrongful misconduct of Development Manager and persons employed or utilized by Development Manager in the performance of this Agreement and/or from any ads or omissions relative to the permitted work and/or to the services being performed by the Development Manager and/or the Contractor which are funded in whole or in part by virtue of this Agreement and/or the failure of either the Development Manager or the Contractor to perform their respective work in accordance with the terms of this Agreement, the design documents, the construction contract between the Contractor and the Development Manager or the failure of either of them to perform their respective work in accordance with applicable laws, codes, rules and regulations. These indemnifications shall survive the term or cancellation of this Agreement. In the event that any action or proceeding is brought against City by reason of any such claim or demand, Development Manager shall, upon written notice from City, resist and defend such action or proceeding by counsel satisfactory to City. Notwithstanding anything to the contrary herein, Development Manager and Contractor shall not be required to provide an indemnification obligation beyond what is provided for in Florida Statutes, Sections 725.06 or 725.08, as applicable, under Florida law. The indemnification provided above shall obligate Development Manager to defend at its own expense to and through appellate, supplemental or bankruptcy proceeding, or to provide for such defense against any and all claims of liability and all suits and actions of every name and description arising by, through or related to this Agreement or related to any work, materials or equipment performed which is funded in whole or in part by this Agreement above which may be brought against City whether performed by Development Manager, or persons employed or utilized by the Development Manager. 35 This indemnity will survive the cancellation or expiration of this Agreement. This indemnity will be interpreted under and construed to conform to the laws of the State of Florida, including without limitation and interpretation §725.06 and/or §725.08, Fla. Statutes, if applicable. Notwithstanding anything to the contrary herein, Development Manager shall not be required to provide any indemnification obligations beyond what is provided for in §725.06(2) and (3), Fla. Statutes, if applicable under Florida law. Additionally, Development Manager shall not be required to indemnify the City for the City's own negligence. Development Manager's indemnity and defense obligations shall be capped at the greater of the insurance proceeds available and actually paid or, if no insurance proceeds are paid, the amount paid by the City pursuant to this Agreement. Development Manager shall require all construction agreements it has with the Contractor include a provision that they will indemnify the City in the manner set forth above. The Development Manager agrees and recognizes that the City shall not be held liable or responsible for any claims which may result from any actions or omissions of the Development Manager in which the City participated either through review or concurrence of the Development Manager's actions. In reviewing, approving or rejecting any submissions by the Development Manager or Contractor or other ads of the Contractor, the City in no way assumes or shares any responsibility or liability of the Development Manager, Contractor or Sub -Contractor under this Agreement. The City agrees and recognizes that the Development Manager shall not be held liable or responsible for any claims which may result from any actions or omissions of the City in which the Development Manager participated solely through review or concurrence of the City's actions. 13. INSURANCE/BONDING The Development Manager shall not authorize the initiation of any element of the Project under this Agreement until the Development Manager has obtained, or required its Contractor to obtain: (i) the insurance required; and (ii) the City's Risk Management Director has approved such insurance. The insurance listed on Exhibit F attached to this Agreement will be the required insurance for this Agreement. On or before the commencement of any Work funded by this Agreement, Development Manager shall require its Contractor obtain a Payment and Performance Bond in the minimum amount of Six Million and One Hundred Thousand ($6,100,000.00) Dollars, in substantially the form prescribed by § 255.05, Fla. Stat., naming the City of Miami as the obligee of such bond (hereinafter, the "Bond"). Such Bond will provide that the contractor named in the bond will properly and timely pay all legal debts arising from the construction work and will perform the Project in accordance with the terms of this Agreement, all applicable laws, codes and regulations, and its construction contract with the Development Manager. The Bond will be furnished to the Director prior to the commencement of any element of the Project under this Agreement. The Bond will be issued by a surety licensed to do business in the State of Florida and rated AV or better per A.M. Best's Key Rating Guide, latest edition. 14. MODIFICATIONS TO COVERAGE AND OWNER'S CONTROLLED INSURANCE PROGRAM The City through its Risk Management Director or authorized designee reserves the right to require modifications, increases, or changes in the required insurance requirements, coverage, deductibles or other insurance obligations and shall provide a thirty (30) day written notice to the Development Manager. In that event Contractor shall comply with such request unless the insurance coverage is not then readily 36 available in the national market, and may request additional consideration from City accompanied by justification. All additional cost will be borne by the Development Manager or Contractor, as applicable. Notwithstanding the insurance requirements required by the City in this Agreement, the City acknowledges that Development Manager may elect to implement an Owner Controlled Insurance Program ("OCIP") for the Project the details of which are consistent with policy attached hereto as Attachment "G". To the extent there is any conflict between the City's insurance requirements of this Agreement and the Development Manager's OCIP, the OCIP requirements shall control. The parties shall reasonably cooperate with each other to coordinate the City's insurance requirements with those of the OCIP. 15. DISCRETION OF DIRECTOR Any matter not expressly provided for herein dealing with the City or decisions of the City shall be within the exercise of the reasonable professional discretion of the City Manager or the City Manager's authorized designee. 16. AUTHORITY OF THE CITY PROJECT MANAGER The Project Manager shall have authority to act on behalf of the City to the extent explicitly provided by the Agreement, unless otherwise delegated to the Development Manager or modified in writing by the City. All instructions to the Development Manager shall be issued in writing. All instructions to the Development Manager shall be issued through the Director or Project Manager. The Project Manager shall have access to the Project Site. The Development Manager shall provide safe facilities for such access so the Project Manager may perform their functions under the Agreement. The Project Manager will make periodic visits to the Project Site to become generally familiar with the progress and quality of the Work, and to determine if the Work is proceeding in accordance with the Contract Documents. The Project Manager will not be responsible for construction means, methods, techniques, sequences or procedures, or for safety precautions and programs in connection with the Construction Work, and will not be responsible for the Development Manager's (through its Contractor) failure to carry out the Construction Work in accordance with the Agreement. The Project Manager will have authority to reasonably reject Construction Work that does not conform to the Contract Documents requirements. Whenever, in his or her opinion, it is considered necessary or advisable to insure the proper implementation of the Contract Documents, the Project Manager will have authority to require special inspections or testing of the Construction Work, whether or not such Construction Work is fabricated, installed or completed. Neither the Project Manager's authority to ad under this Article, nor any decision made by him/her in good faith either to exercise or not to exercise such authority, shall give rise to any duty or responsibility of the Project Manager to the Development Manager, Contractor any Subcontractor, supplier or any of their agents, employees, or any other person performing any of the Construction Work. All interpretations and recommendations of the Project Manager shall be consistent with the intent of the Contract Documents. 37 The Project Manager will not be responsible for the ads or omissions of the Development Manager, its Contractor, or anyone employed or contracted directly or indirectly by the Development Manager, including any Sub -Contractor, or any of their agents or employees, or any other persons performing any of the Work. 17. SUBCONTRACTS A Sub -Contractor is any person or entity that is performing, furnishing, supplying or providing any portion of the Construction Work pursuant to a contract with the Development Manager or its Contractor. Development Manager, through its Contractor, shall be solely responsible for and have control over the Sub -Contractors. 18. OWNERSHIP & USE OF DOCUMENTS The Drawings, Specifications and other documents prepared by the A/E(s), and copies thereof furnished to the Development Manager and/or its Contractor, are for use solely with respect to this Agreement. 19. CONTINUING THE WORK Development Manager through its Contractor shall carry on the Work and adhere to the progress schedule during all disputes or disagreements with City, including, without limitation, disputes or disagreements concerning the Contract timeframe for completion of the Work. The Work shall not be delayed or postponed pending resolution of any disputes or disagreements. All disputes shall be resolved in accordance with Article 51, Resolution of Contract Disputes and Article 52 Mediation- Waiver of Jury Trial. 20. PUBLIC ENTITY CRIMES In accordance with the Public Crimes Ad, Section 287.133, Florida Statutes (2025), a person or affiliate who is a contractor, consultant or other provider, who has been placed on the convicted vendor list following a conviction for a public entity crime may not submit a bid on a contract to provide any goods or services to the City, may not submit a bid on a contract with the City for the construction or repair of a public building or public work, may not submit bids on leases of real property to the City, may not be awarded or perform work as a contractor, supplier, or subcontractor, under a contract with the City, and may not transact any business with the City in excess of the threshold amount provided in Section 287.017, Florida Statutes, for category two purchases for a period of 36 months from the date of being placed on the convicted vendor list. Violation of this section by Development Manager shall result in cancellation of this Agreement by the City and may result in Development Manager's debarment. 21. NON-DISCRIMINATION: EQUAL EMPLOYMENT OPPORTUNITY & AMERICANS WITH DISABILITIES ACT Development Manager warrants and represents that it does not and will not engage in discriminatory practices and that there shall be no discrimination in connection with Development Manager or it Contractor's performance under this Agreement on account of race, color, sex, religion, age, handicap, marital status or national origin. Development Manager further covenants that no otherwise qualified individual shall, solely by reason of his/her race, color, sex, religion, age, handicap, marital status 38 or national origin, be excluded from participation in, be denied services, or be subject to discrimination under any provision of this Agreement. Development Manager and its Contractor shall affirmatively comply with all applicable provisions of the Americans with Disabilities Ad (ADA) in the course of providing any services funded by City, including Titles I and II of the ADA (regarding nondiscrimination on the basis of disability), and all applicable regulations, guidelines, and standards. In addition, Development Manager shall take affirmative steps to ensure nondiscrimination in employment against disabled persons. 22. AUDIT RIGHTS At any time during normal business hours and after reasonable notice has been provided, there shall be made available to the City and/or representatives of the City to audit, examine, and make audits of all contracts, invoices, materials, payrolls, records of personnel, conditions of employment and other reasonable data in Development Manager's possession and relating to this Agreement. It is further understood that all records and supporting documents pertaining to this Agreement shall be maintained for a minimum period of four (4) years. The retention and access period starts from the date of the submission of the annual performance and evaluation report in which the specific activity is reported for the final time. Records subject to the provisions of Public Record Law, Florida Statutes Chapter 119, shall be kept in accordance with such statute. Otherwise, for the purpose of such audits, inspections, examinations and evaluations, the City's agent or authorized representative shall have access to said records from the effective date of this Agreement, for the duration of the Work, and until 4 years after the date of final payment by the City to Construction pursuant to this Agreement. The City's agent or its authorized representative shall have access to the Development Manager's facilities, shall have access to all necessary records, and shall be provided adequate and appropriate work space, in order to conduct audits in compliance with this provision. The City or its authorized representative shall give auditees reasonable advance notice of intended audits. If an audit inspection or examination in accordance with this Article discloses overcharges in excess of two percent (2%) except negotiated fees by the Development Manager to the City, fifty percent (50%) of the actual cost of the City's audit shall be paid by the Development Manager. If the audit discloses contract billing or charges to which Development Manager is not contractually entitled, Development Manager shall pay over to the City said sum within 20 days of receipt of a written demand unless otherwise agreed to by both parties in writing. If any litigation, claim, negotiation, audit or other action involving the records has been started before the expiration of the four (4) year period, the records must be retained until completion of the action and resolution of all issues which arise from it or until the end of the four (4) year period, whichever is later. During the course of an audit, if the City determines that any payment made to the Development Manager does constitute an allowable expenditure, then the City will have the right to deduct or reduce those amounts from the related invoices. The Development Manager must maintain records necessary to document compliance with the provisions of the Agreement. The Development Manager acknowledges that additionally the City has the audit and inspection rights set forth in §18-100 to §18-102, City Code, as amended. 39 23. OSHA COMPLIANCE The Development Manager warrants that it will comply with all safety precautions as required by federal, state or local laws, rules, regulations and ordinances. 24. SAFETY PRECAUTIONS Development Manager, itself and through its Contractor, shall comply with all applicable laws, ordinances, rules, regulations and orders of any public body having jurisdiction for the safety of persons or property or to protect them from damage, injury or loss; and shall erect and maintain all necessary safeguards for such safety and protection. Development Manager through its Contractor shall notify owners of adjacent property and utilities when prosecution of the Construction Work may affect them. All damage, injury or loss to any property, caused directly or indirectly, in whole or in part, by Development Manager, Contractor, any Sub -Contractor or anyone directly or indirectly employed by any of them or anyone for whose ads any of them may be liable, shall be remedied by Development Manager. Development Manager's duties and responsibilities for the safety and protection of the Construction Work shall continue until such time as all the Construction Work is completed and City has issued to Development Manager a notice of Final Acceptance, said notice shall not be unreasonably withheld or delayed. Development Manager must adhere to the applicable environmental protection guidelines for the duration of the Project. If hazardous waste materials are used, detected or generated at any time, the City's Project Manager must be immediately notified of each and every occurrence. The Development Manager shall comply with all codes, ordinances, rules, orders and other legal requirements of public authorities (including, without limitation, OSHA, EPA, DERM, the City, Miami -Dade County, State of Florida, and Florida Building Code) which bear on the performance of the Construction Work. Development Manager shall require that Contractor ensure that all Work is performed using adequate safeguards, including but not limited to: proper safe rigging, safety nets, fencing, scaffolding, barricades, chain link fencing, railings, barricades, steel plates, safety lights, and ladders that are necessary for the protection of its employees, as well as the public and City employees. All riggings and scaffolding shall be constructed with good sound materials, of adequate dimensions for their intended use, and substantially braced, tied or secured to insure absolute safety for those required to use it, as well as those in the vicinity. All riggings, scaffolding, platforms, equipment guards, trenching, shoring, ladders and similar actions or equipment shall be OSHA approved, as applicable, and in accordance with all federal state and local regulations. If an emergency condition should develop during the Project, the Development Manager must immediately notify the City's Project Manager of each and every occurrence. The Development Manager should also recommend any appropriate course(s) of action to the City's Project Manager. 25. PERMITS & LICENSES Except as otherwise provided within the Agreement, all permits and licenses required by federal, state or local laws, rules and regulations necessary for the prosecution of the Construction Work undertaken by Development Manager pursuant to this Agreement shall be secured by Development Manager with each party paying such permit costs allocable to improvements related to its portion of the 40 Project. It is Contractor's responsibility to have and maintain appropriate Certificate(s) of Competency, valid for the Construction Work to be performed and valid for the jurisdiction in which the Construction Work is to be performed for all persons working on the Project for whom a Certificate of Competency is required. 26. COMPLIANCE WITH LAWS Development Manager and its Contractor shall comply with all applicable laws, codes, ordinances, rules, regulations and resolutions and all applicable guidelines and standards in performing its duties, responsibilities, and obligations related to this Agreement. 27. DEFECTIVE WORK The City's Project Manager shall have the authority to reject or disapprove Construction Work which it finds to be defective. If required by the City, Development Manager, through its Contractor, shall promptly either correct all defective work or remove such defective Construction Work and replace it with non -defective Work. Development Manager shall bear all direct and indirect costs of such removal or corrections including cost of testing laboratories and personnel. Should Development Manager, through its Contractor, fail or refuse to remove or correct any defective Work or to make any necessary repairs in accordance with the requirements of the Contract Documents within a reasonable time after notice in writing provided by the City, the City shall have the authority to cause the defective work to be removed or corrected, or make such repairs as may be reasonably necessary at Development Manager's expense. Any reasonable expense incurred by City in making such removals, corrections or repairs, shall be paid for out of any monies due or which may become due to Development Manager. In the event of failure of Development Manager to make all necessary repairs promptly and fully, which is not cured in the Cure Period, the City may declare Development Manager in default. If, within one (1) year after the date of Substantial Completion or such longer period of time as may be prescribed by the terms of any applicable special warranty required by the Contract Documents, or by any specific provision of the Contract Documents, any of the Construction Work is found to be defective or not in accordance with the Contract Documents, Development Manager, after receipt of written notice from City, shall promptly correct such defective or nonconforming Construction Work within the time specified by City without cost to the City. Nothing contained herein shall be construed to establish a period of limitation with respect to any other obligation which Development Manager might have under the Contract Documents including but not limited to any claim regarding latent defects. 28. WARRANTY OF MATERIALS AND EQUIPMENT Development Manager through its Contractor warrants to City that all materials and equipment furnished under this Agreement will be new unless otherwise specified and that all of the Construction Work will be of good quality, free from faults and defects and in conformance with the Contract Documents. All equipment and materials not conforming to these requirements, including substitutions not properly approved and authorized, may be considered defective. If required by City, Development Manager shall furnish satisfactory evidence as to the kind and quality of materials and equipment. This warranty is not limited by any other provisions within the Contract Documents. 41 29. WARRANTY OF CONSTRUCTION The Development Manager, through its Contractor shall warrant that the Construction Work conforms to the Agreement and is free of any patent and/or latent defect of the workmanship for a minimum period of one year from the date of Substantial Completion. The Development Manager's obligation under this warranty shall be at its own cost and expense, to promptly repair or replace (including cost of removal and installation), that item (or part or component thereof) which proves defective or fails to comply with the Agreement within the warranty period such that it complies with the Agreement. 30. MANUFACTURER'S WARRANTY Development Manager through the Contractor shall provide to City all manufacturers' warranties. All warranties, expressed and/or implied, shall be given to the City for all material and equipment covered by this Agreement. All material and equipment furnished shall be fully guaranteed by the Development Manager, through the Contractor, against factory defects and workmanship at time of installation. At no expense to the City, the Development Manager shall correct any and all apparent and latent defects that are required by Florida law. The Contract Documents may supersede the manufacturer's standard warranty. 31. No DAMAGES FOR DELAY In the event of any delays to the Project that are caused by actions or events that are out of the control of the owner or entities hired or control by the owner, the Contractor's sole remedy shall be to seek an extension of time in accordance with the terms of the Agreement. The City shall not be liable for any delay damages or damages attributable to performing Construction Work out of sequence, acceleration claims or other similar type claims, incurred by Contractor arising out of or in any way associated with the performance under this Agreement. No claim for damages or any claim, other than for an extension of time, shall be made or asserted against the City because of any delays except as provided herein. Development Manager shall not be entitled to an increase in the Contract Price or payment or compensation of any kind from City for direct, indirect, consequential, impact or other costs, expenses or damages, including but not limited to costs of acceleration or inefficiency, arising because of delay, disruption, interference or hindrance from any cause whatsoever, whether such delay, disruption, interference or hindrance be reasonable or unreasonable, foreseeable or unforeseeable, or avoidable or unavoidable. Otherwise, Development Manager shall be entitled only to extensions of the Contract Time as the sole and exclusive remedy for such resulting delay, in accordance with and to the extent specifically provided above. 32. EXCUSABLE DELAY Development Manager is entitled to a time extension of the Construction Work Time for Completion for each day the Construction Work is delayed due to Excusable Delay. Development Manager shall document its claim for any time extension as provided in Article 35 hereof. Where Development Manager determines that the City is liable for payment of costs due to a delay, 42 any request for additional compensation must be submitted in accordance with Article 9. Development Manager shall furnish to the City's Project Manager all documentation supporting its claim, including details of the claim, a description of the work affected and the actual costs resulting from the delay. Where the City agrees, in writing, to an excusable delay and the Work is being performed by the Development Manager, the Development Manager shall be reimbursed for actual, direct costs associated with the delay. The Development Manager agrees that the above constitutes its sole and exclusive remedies for an Excusable Delay. Failure of Development Manager to materially comply with Article 32 hereof as to any particular event of delay shall be deemed conclusively to constitute a waiver, abandonment or relinquishment of any and all claims resulting from that particular event of delay. The Guaranteed Maximum Cost can never be exceeded or increased, except by an approved change order or approved CCD. 33. NOTIFICATION AND CLAIM FOR CHANGE OF CONSTRUCTION WORK TIME Any request for a change in the Time for Completion due to Force Majeure Events, as defined below, or any other delay, shall be made by written notice by Development Manager to the Project Manager within the timeframe set forth in Section 35 below. Thereafter, within twenty (20) calendar days of the termination of the event giving rise to the claim, written notice of the extent of the claim with supporting information and documentation shall be provided unless City allows an additional period of time to ascertain more accurate data in support of the claim and such notice shall be accompanied by Development Manager's written notarized statement that the adjustment claimed is the entire adjustment to which the Development Manager has reason to believe it is entitled as a result of the occurrence of said event. The Time for Completion will be extended in an amount equal to time lost on critical Construction Work items due to delays resulting directly from Force Majeure Events. 34. CHANGES IN THE WORK OR TERMS OF CONTRACT DOCUMENTS Without invalidating the Agreement and without notice to any Surety, City reserves and shall have the right, from time to time to make such increases, decreases or other changes in the character or quantity of the Construction Work as may be considered necessary or desirable to complete fully and acceptably the proposed construction in a satisfactory manner. Any extra or additional work within the scope of this Project must be issued in writing in accordance with the requirements of this Agreement. Any changes to the terms of the Contract Documents must be contained in a written document, executed by the parties hereto, with the same formality and of equal dignity prior to the initiation of any Construction Work reflecting such change. This Article shall not prohibit the issuance of Change Orders executed only by City as hereinafter provided. 35. FORCE MAIEURE Should any failure to perform on the part of Development Manager be due to a Force Majeure Event, then the City shall allow an extension of time reasonably commensurate with the cause of such failure to perform or cure. 43 If the Development Manager is delayed in performing any obligation under this Agreement due to a Force Majeure Event , the Development Manager shall request a time extension from the City within seven (7) working days of the conclusion of said Force Majeure Event. Any time extension shall be subject to mutual agreement and shall not be cause for any claim by the Development Manager for extra compensation. 36. FIELD DIRECTIVES The City's Project Manager may at times issue Field Directives to the Development Manager based on visits to the Project site. Such Field Directives shall be issued in writing and the Development Manager shall be required to comply with such reasonable directives. Where the Development Manager believes that the directive is outside the scope of the Construction Work or unreasonable, the Development Manager shall, within 48 hours, advise the City's Project Manager that the Field Directive is either unreasonable and/or outside the scope of the Work. At that time the Field Directive may be rescinded, or the Development Manager may be required to submit a request for a change order proposal. Where the Development Manager is notified of the City's position that the Field Directive is within the scope and/or reasonable and the Development Manager disagrees, the Development Manager shall notify the City's Project Manager that the Development Manager reserves the right to make a claim for the time and monies based on the Field Directive. At no time shall the Development Manager unreasonably refuse to comply with the directive. Failure to reasonably comply with the directive may result in a determination that the Development Manager is in default of the Agreement. 37. CHANGE ORDERS Changes in the quantity or character of the Construction Work of the Project which are not properly the subject of field directives or supplemental instructions, including all changes resulting in changes in the contract price or time shall be authorized only by change orders approved in advance by City and Development Manager and issued in accordance with the terms of this Agreement. All changes to Work must be approved in advance in accordance with the value of the change order or the calculated value of the time extension. All change orders increasing the value of the Agreement by $50,000 or more shall be approved in advance by the City Commission. All change orders increasing the value of the Agreement by less than $50,000 in the aggregate may be approved in advance by the City Manager or his designee. 38. VALUE OF CHANGE ORDER WORK The value of any Work to be covered by a change order, or for any claim for an increase or decrease in the Agreement, shall be determined in one of the following ways: • Where the Work involved is covered by unit prices contained in the Schedule of Values, by application of unit prices to the quantities of items involved. • By mutual acceptance of a lump sum which Development Manager and City acknowledge contains a component for overhead and profit. 44 39. INSPECTION OF WORK The City shall at all times have access to the Construction Work during normal work hours. Inspectors sent in the City's proprietary capacity shall have no authority to permit deviations from, or to relax any of the provisions of the Contract Documents or to delay the Construction Work by failure to inspect the materials and Construction Work with reasonable promptness without the written permission or instruction of City. The foregoing shall not serve to limit the City's regulatory authority as set forth under applicable laws. The payment of any compensation, whatever may be its character or form, or the giving of any gratuity or the granting of any favor by Development Manager to any inspector, directly or indirectly, is strictly prohibited, and any such ad on the part of Development Manager will constitute a breach of this Agreement. 40. SUBMITTALS All submittals for the Work shall be completed by the Architect/Engineer ("A/E"). City shall not be liable for any materials, fabrication of products or other Work commenced that requires submittals until the City has returned approved submittals to the Contractor. City shall make every effort to review submittals within ten (10) calendar days from the date of receipt by the City. City's review shall only be for conformance with design concepts and the information provided in the Contract Documents. The approval of a separate item shall not constitute approval of an assembly in which the item functions. The City shall return the shop drawings to the Development Manager for its use and distribution. Approval of any submittal shall not relieve the Development Manager and Contractor of any responsibility for any deviations from the requirements of the Contract Documents unless the Development Manager has given written notice to the City of the specific deviations and the City has issued written approval of such deviations. Development Manager shall be responsible for the distribution of all shop drawings, copies of product data and samples, which bear the A/E and City's stamp of approval. Distribution shall include, but not be limited to: job site file, record documents file, sub -contractors, suppliers, and other affected contractors or entities that require the information. During the progress of the Construction Work, the Development Manager shall submit copies of all reports, permits and inspections required by governing authorities, or necessary for the Project. 41. SUBSTITUTIONS Development Manager shall submit all requests for substitutions to the City for review and approval. All such requests shall include sufficient documentation to support such request. City may request additional information as deemed necessary to properly review such requests. 45 42. SHOP DRAWINGS Development Manager, through the Contractor shall submit Shop Drawings as required by the Contract Documents. The purpose of the Shop Drawings is to show, in detail, the suitability, efficiency, technique of manufacture, installation requirements, and details of the item and evidence of its compliance or noncompliance with the Contract Documents. If the Shop Drawings show or indicate departures from the Contract Documents' requirements, Development Manager, through the Contrador shall make specific mention thereof in its letter of transmittal. Failure to point out such departures shall not relieve Development Manager from its responsibility to comply with the Contract Documents. City shall review and approve Shop Drawings within ten (10) calendar days from the date received, unless said Shop Drawings are rejected by City for material reasons. City's approval of Shop Drawings will be general and shall not relieve Development Manager of responsibility for the accuracy of such Shop Drawings, nor for the proper fitting and construction of the work, nor for the furnishing of materials or work required by the Contract Documents and not indicated on the Shop Drawings. No work called for by Shop Drawings shall be performed until the said Shop Drawings have been approved by City. Approval shall not relieve Development Manager from responsibility for errors or omissions of any sort on the Shop Drawings. No approval will be given to partial submittals of Shop Drawings for items which interconnect and/or are interdependent where necessary to properly evaluate the design. It is Development Manager's, through the Contractor, responsibility to assemble the Shop Drawings for all such interconnecting and/or interdependent items, check them and then make one submittal to City along with its comments as to compliance, noncompliance, or features requiring special attention. If catalog sheets or prints of manufacturers' standard drawings are submitted as Shop Drawings, any additional information or changes on such drawings shall be typewritten or lettered in ink. Each shop drawing shall be clear, thoroughly detailed and shall have listed on it all Contract Document references, drawing number(s), specification section number(s) and the shop drawing numbers of related work. Shop drawings must be complete in every detail, including location of the work. Materials, gauges, methods of fastening and spacing of fastenings, connections with other work, cutting, fitting, drilling and any and all other necessary information per standard trade practices or as required for any specific purpose shall be shown. Where professional calculations and/or certification of performance criteria of materials, systems, and or equipment are required, the City is entitled to rely upon the accuracy and completeness of such calculations and certifications submitted by the Development Manager. Calculations, when required, shall be submitted in a neat clear and easy format to follow. Development Manager shall keep one set of Shop Drawings marked with A/E and City's approval at the job site at all times. 43. PRODUCT DATA Development Manager, through the Contrador shall submit a copy of product data. Copies must 46 be marked to identify applicable products, models, options and other data. Development Manager, through the Contractor shall supplement manufacturer's standard data to provide information unique to the Construction Work. Development Manager, through the Contractor shall only submit pages that are pertinent. Submittals shall be marked to identify pertinent products, with references to the specifications and the Contract Documents. Identify reference standards, performance characteristics and capacities, wiring and piping diagrams and controls, component parts, finishes, dimensions and required clearances. 44. AS -BUILT DRAWINGS During the Construction Work, Development Manager, through the Contractor shall maintain records of all deviations from the Drawings and Specifications as approved by the City and prepare As - Built Record Drawings showing correctly and accurately all changes and deviations made during construction to reflect the work as it was actually constructed. It is the responsibility of the Development Manager, through the Contractor to check the As -Built Drawings for errors and omissions prior to submittal to the City and certify in writing that the As -Built Drawings are correct and accurate, including the actual location of all internal piping, electrical/signal conduits in or below the concrete floor. Indicate the size, depth and voltage in each conduit. Legibly mark to record actual construction: On -site structures and site work as follows: • Depths of various elements of foundation in relation to finish first floor datum. All underground piping and ductwork with elevations and dimensions and locations of valves, pull boxes, etc. Changes in location. Horizontal and vertical locations of underground utilities and appurtenances, referenced to permanent surface improvements. Actual installed pipe material, class, etc. Location of internal utilities and appurtenances concealed in the construction, referenced to visible and accessible features of the structure. Air conditioning duds with locations of dampers, access doors, fans and other items needing periodic maintenance. • Field changes in dimensions and details. • Changes made by City's written instructions or by Change Order. • Details not on original Contract Drawings. • Equipment, conduit, electrical panel locations. • City schedule changes according to Contractor's records and shop drawings. Specifications and Addenda: Legibly mark each section to record: • Manufacturer, trade name, catalog number and Supplier of each product and item of equipment actually installed. • Approved Shop Drawings: Provide record copies for each process, equipment, piping, electrical system and instrumentation system. 47 45. REQUESTS FOR INFORMATION (RFI) The Development Manager or its Contractor shall submit in writing a Request for Information (RFI) to the City's Project Manager or A/E, as applicable, where the Development Manager or Contractor believe that the specifications or drawings are unclear or conflict. All requests must be submitted in a manner that clearly identifies the drawing and/or specification section where clarification or interpretation is being requested. 46. CITY'S RIGHT TO TERMINATE The City Manager has the right to terminate this Agreement for any reason or no reason, upon thirty (30) days written notice. Such written notice shall state the date upon which Development Manager shall cease all Construction Work under this Agreement and vacate the Project site. Upon termination of this Agreement, all charts, sketches, studies, drawings, reports and other documents, including electronic documents, related to Construction Work authorized under this Agreement, whether finished or not, must be turned over to the City. The Development Manager shall be paid for Construction Work performed and accepted by the City, provided that said documentation is turned over to City within twenty (20) business days of termination. Failure to timely deliver the documentation shall be cause to withhold any payments due without recourse by Development Manager until all documentation is delivered to the City. In such event, the City shall pay to Development Manager Compensation for Services rendered and approved expenses incurred prior to the effective date of termination. In no event shall the City be liable Development Manager for any additional compensation and expenses incurred, other than that provided herein, and in no event shall the City be liable for any consequential or incidental damages. 47. TERMINATION BY DEFAULT If Development Manager fails to comply with any material term or condition of this Agreement, or fails to perform any of its obligations hereunder, then Development Manager shall be in default. Upon the occurrence of a default which is not cured within the Cure Period, in addition to all remedies available to it by law, the City may immediately, upon written notice to Development Manager, terminate this Agreement. The City may also suspend any payment or part thereof or order a Work stoppage until such time as the issues concerning compliance are resolved. Development Manager understands and agrees that termination of this Agreement under this Article shall not release Development Manager from any obligation accruing prior to the effective date of termination. In the event of termination due to default, in addition to the foregoing Development Manager shall be liable for all costs and expenses incurred by the City in the procurement of the Construction Work under this Agreement. In the event of Default, the City may also issue a Notice to Cure and suspend or withhold payments to Development Manager until such time as the actions giving rise to default have been cured. In no event shall the Development Manager be liable to the City for any additional expenses incurred, other than that provided herein, and in no event shall the Development Manager be liable for any consequential or incidental damages. A finding of default and subsequent termination for cause may include, without limitation, any of the following: 48 • Development Manager fails to obtain the insurance herein required. • Development Manager fails to comply with any of its duties under this Agreement, with any terms or conditions set forth in this Agreement beyond the specified period allowed to cure such default. • Development Manager fails to commence the Work within the timeframes provided or contemplated herein, or fails to complete the Work in a timely manner as required by this Agreement. The City shall provide Written Notice to Cure to Development Manager as to a finding of default, and Development Manager shall take all necessary action to Cure said default within such time as stipulated in the Written Notice. Such Written Notice shall provide a minimum of 30 days to Cure any alleged default. Such time to Cure shall be at the sole discretion of the City but be no less than 30 days. The City may extend the Cure Period at its sole discretion or terminate the Agreement upon failure of the Development Manager to cure such default in the specified timeframe. 48. DEVELOPMENT MANAGER'S RIGHT TO TERMINATE The Development Manager shall have the right to terminate this Agreement, in writing, following breach by the City, if breach of contract has not been corrected within thirty (30) days from the date of the City's receipt of a written notice from Development Manager specifying the City's breach of its duties under this Agreement. The City shall only be responsible for payment of Development Manager compensation for Services rendered and approved expenses incurred prior to the effective date of termination. In no event shall the City be liable to Development Manager for any additional compensation and expenses incurred, other than that provided herein, and in no event shall the City be liable for any consequential or incidental damages. 49. MATERIALITY AND WAIVER OF BREACH City and Development Manager agree that each requirement, duty, and obligation set forth in these Contract Documents is substantial and important to the formation of this Agreement. The parties failure to enforce any provision of this Agreement shall not be deemed a waiver of such provision or modification of this Agreement. A waiver of any breach of a provision of this Agreement shall not be deemed a waiver of any subsequent breach and shall not be construed to be a modification of the terms of this Agreement. 50. ACCEPTANCE AND FINAL PAYMENT Upon receipt of written notice from Development Manager that the Construction Work is ready for final inspection and acceptance, the City shall, within ten (10) calendar days, make an inspection thereof. If City's Project Manager find the Work acceptable, the requisite documents have been submitted and the requirements of the Contract Documents fully satisfied, and all conditions of the permits and regulatory agencies have been met, a Final Certificate for Payment (Attachment E) shall be issued by City's Project Manager, over its signature, stating that the requirements of the Contract Documents have been performed and the Work is ready for acceptance under the terms and conditions thereof. 49 Before issuance of the Final Certificate for Payment, Development Manager shall deliver to City's Project Manager a conditional release of all liens arising out of this Agreement, or receipts in full in lieu thereof; an affidavit certifying that all suppliers, Sub -Contractors, and Contractor have been or will be (out of the final payment) paid in full and that all other indebtedness connected with the Construction Work has been or will be paid; the final corrected As -Built Drawings; the Record Set; and the final bill of materials, if required, and Application for Payment. Development Manager shall deliver the written Contractor's and all Manufacturer's warranties prior to issuance of the Final Certificate for Payment. If, after the Construction Work has been substantially completed, full completion thereof is materially delayed through no fault of Development Manager or its Contractor, and NE so certifies, City shall, upon certificate of City's Project Manager, and without terminating the Agreement, make payment of the balance due for that portion of the Work fully completed and accepted. Such payment shall be made under the terms and conditions governing final payment, except that it shall not constitute a waiver of unknown claims. The making of and acceptance of final payment shall constitute a waiver of all claims by Development Manager and the City, except to the extent such claims are a result of Development Manager's failure to comply with the obligations set forth in this Agreement, including but not limited to those identified by Development Manager or the City as unsettled at the time of the application for final payment. 51. RESOLUTION OF CONTRACT DISPUTE Development Manager understands and agrees that all disputes between it and the City based upon an alleged violation of the terms of this Agreement by the City shall be initially submitted to the Diredor for resolution. Upon receipt of the submittal from the Development Manager, the Diredor shall render a decision within fourteen (14) calendar days. Where a mutually satisfactory resolution cannot be reached the Development Manager may submit the dispute to the City Manager or his/her designee for resolution. Where a mutual resolution cannot be reached between the Development Manager and the City Manager or designee, the Development Manager, prior to being entitled to seek judicial relief shall comply with Article 51 of this Agreement, in connection therewith. Should the amount of City Contribution hereunder exceed $4.1 million, the City Manager's decision shall be approved or disapproved by the City Commission. Development Manager shall not be entitled to seek judicial relief unless: • It has first received City Manager's written decision, approved by the City Commission, if applicable, or • A period of sixty (60) days has expired after submitting to the City Manager a detailed statement of the dispute, accompanied by all supporting documentation or a period of seventy-five (75) days has expired where City Manager's decision is subject to City Commission approval; and • Mediation of the dispute, as stipulated in Article 52, has not resulted in a mutual resolution; or • City has waived compliance with the procedure set forth in this Article by written instrument(s) signed by the City Manager. 50 If Development Manager is required to file a lawsuit in order to meet a statute of limitations before it has complied with any of the above requirements, it shall be entitled to file the action and then the City may move to stay the action to allow the Development Manager to comply with the conditions precedent to litigation as set forth in this Agreement. 52. MEDIATION — WAIVER OF JURY TRIAL In an effort to engage in a cooperative effort to resolve conflict which may arise during the course of the design and/or construction of the Project, and/or following the completion of the Project, the parties to this Agreement agree all unresolved disputes between them shall be submitted to non -binding mediation prior to the initiation of litigation, unless otherwise agreed in writing by the parties. A certified Mediator, who the parties find mutually acceptable, will conduct any Mediation Proceedings in Miami - Dade County, State of Florida. The parties will share the costs of the certified Mediator equally. In an effort to expedite the conclusion of any litigation, the parties voluntarily waive their right to jury trial in any action arising under this Agreement. 53. SUBSTANTIAL COMPLETION, PUNCH LIST AND FINAL -COMPLETION The Construction Work shall be substantially complete when the City's Project Manager, in the reasonable exercise of his/her discretion determines that the Construction Work is complete, there are no material and/or substantial variations from the Agreement, and the Construction Work is fit for its intended purpose. City's Project Manager shall not unreasonably withhold or delay its approval. Upon Substantial Completion, City's Project Manager and the Development Manager shall sign the Substantial Completion Inspection Form. The signing of this form shall not relieve the Development Manager from its obligation to complete the Project. When the Development Manager believes that the Construction Work is substantially complete, the Development Manager shall request in writing that the City inspect the Construction Work to determine if Substantial Completion has been achieved. No request for Substantial Completion inspection is to be submitted until the Development Manager has obtained a Certificate(s) of Occupancy, Certificate of Completion, or other equivalent. The City shall schedule the date and time for any inspection and notify the Development Manager and any other parties deemed necessary. During this inspection, the Project Substantial Completion Inspection Form, (Attachment B), will be completed as necessary. Any remaining Construction Work shall be identified on this form and shall be known as Punch List work. The Punch List, (Attachment C), shall be signed by the City's Project Manager and the Development Manager confirming that the Punch List contains the item(s) necessary to complete the Construction Work. The failure or refusal of the Development Manager to sign the Project Substantial Completion Inspection Form or Punch List shall not relieve the Development Manager from complying with the reasonable findings of the Project Substantial Completion Inspection and completing the Project to the satisfaction of the City. Where the Punch List is limited to minor omissions and defects, the City shall indicate that the Construction Work is substantially complete subject to completion of the Punch List. Where the City determines, on the appropriate form that the Construction Work is not substantially complete, the City shall provide a list of all open items necessary to achieve Substantial Completion. Upon completion of such Construction Work, the Development Manager shall request another Substantial Completion inspection. The City's Project Manager and the Development Manager shall agree on the time reasonably 51 required to complete all remaining Construction Work included in the Punch List. Upon the receipt of all documentation, resolution of any outstanding issues and issuance of final payment, the City shall notify the Development Manager in writing of the closeout of the Project. The City will prepare a Certificate of Substantial Completion in the form attached hereto as Attachment D which shall establish the Date of Substantial Completion. Once substantial completion is achieved the City shall be responsible for security, maintenance, heat, utilities, damage to the Project site, and insurance; and shall list all Construction Work yet to be completed to satisfy the requirements of the Contract Documents for Final Completion. The failure to include any items of corrective work on such list does not alter the responsibility of Development Manager to complete all of the Construction Work in accordance with the Contract Documents. Warranties required by the Contract Documents shall commence on the date of Substantial completion of the Construction Work or designated portion thereof unless otherwise provided in the Certificate of Substantial Completion. 54. APPLICABLE LAW AND VENUE OF LITIGATION This Agreement shall be interpreted and construed in accordance with and governed by the laws of the State of Florida. Any suit or action brought by any party, concerning this Agreement, or arising out of this Agreement, shall be brought in Miami -Dade County, Florida. Each party shall bear its own attorney's fees except in actions arising out of Development Manager's duties to indemnify the City under this Agreement where Development Manager shall pay the City's reasonable attorney's fees. 55. INDEPENDENT CONTRACTOR Development Manager is an independent contractor under this Agreement. Services provided by Development Manager pursuant to this Agreement shall be subject to the supervision of Contractor. In providing such services, neither Development Manager nor its agents shall act as officers, employees, or agents of the City. Development Manager further understands that Florida Workers' Compensation benefits available to employees of the City are not available to Development Manager, and agrees to provide workers' compensation insurance for any employee, or entity working for the Development Manager rendering services to the City under this Agreement. This Agreement shall not constitute or make the parties a partnership or joint venture. 56. SUCCESSORS AND ASSIGNS The performance of this Agreement shall not be transferred pledged, sold, delegated or assigned, in whole or in part, by the Development Manager without the written consent of the City. It is understood that a sale of the majority of the stock or partnership shares of the Development Manager, a merger or bulk sale, an assignment for the benefit of creditors shall each be deemed transactions that would constitute an assignment or sale hereunder requiring prior City approval. The Development Manager's services are unique in nature and any transference without City Commission approval shall be cause for the City to nullify this Agreement. Any assignment without the City's consent shall be null and void. The Development Manager shall have no recourse from such cancellation. The City may require bonding, other security, certified financial statements and tax returns from any proposed assignee and the execution of an assignment/assumption agreement in a form satisfactory to the City Attorney as a condition precedent to considering approval of an assignment. 52 57. THIRD PARTY BENEFICIARIES Neither Development Manager nor the City intends to directly or substantially benefit a third party by this Agreement. Therefore, the parties agree that there are no third -party beneficiaries to this Agreement and that no third party shall be entitled to assert a claim against either of them based upon this Agreement. The parties expressly acknowledge that it is not their intent to create any rights or obligations in any third person or entity under this Agreement. 58. JOINT PREPARATION- INTERPRETATION The language of this Agreement has been agreed to by both parties to express their mutual intent and no rule of strict construction shall be applied against either party hereto. The headings contained in this Agreement are for reference purposes only and shall not affect in any way the meaning or interpretation of this Agreement. All personal pronouns used in this Agreement shall include the other gender, and the singular shall include the plural, and vice versa, unless the context otherwise requires. Terms such as "herein," "hereof," "hereunder," and "hereinafter" refer to this Agreement as a whole and not to any particular sentence, article, paragraph, or section where they appear, unless the context otherwise requires. Whenever reference is made to a Section or Article of this Agreement, such reference is to the Section or Article as a whole, including all of the subsections of such Section or Article, unless the reference is made to a particular subsection. 59. AMENDMENTS No modification, amendment, or alteration in the terms or conditions contained herein shall be effective unless contained in a written document prepared with the same or similar formality as this Agreement and executed by the City Manager and Development Manager. 60. SEVERABILITY Should any provision of this Agreement is determined by a Court of competent jurisdiction to be illegal or unenforceable, then such unenforceable or unlawful provision shall be excised from this Agreement, and the remainder of this Agreement shall continue in full force and effect. Notwithstanding the foregoing, if the result of the deletion of such provision will materially and adversely affect the rights of either party, such party may elect, at its option, to terminate this Agreement in its entirety. An election to terminate this Agreement based upon this provision shall be made within seven (7) days after the finding by the court becomes final. 61. ENTIRE AGREEMENT This Agreement, as it may be amended from time to time, represents the entire and integrated agreement between the City and the Development Manager and supersedes all prior negotiations, representations or agreements, written or oral. This Agreement may not be amended, changed, modified, or otherwise altered in any respect, at any time after the execution hereof, except by a written document executed with the same formality and equal dignity herewith. Waiver by either party of a breach of any provision of this Agreement shall not be deemed to be a waiver of any other breach 53 62. CONFLICT OF INTEREST Development Manager covenant that no person under its employ who presently exercises any functions or responsibilities on behalf of the City in connection with this Agreement has any personal financial interests, direct or indirect, with the Contractor. Development Manager further covenants that, in the performance of the Agreement, no person having such conflicting interest shall be employed. Any such interest on the part of the Contractor or its employees must be disclosed in writing to the City. Development Manager is aware of the conflict -of -interest laws of the City, Miami City Code Sec. 2-11, Miami -Dade County, Florida, Miami -Dade County Code Sec. 2-11.1; and the State of Florida, Chapt. 112, Part III, Florida Statutes, as amended, and agrees that it shall fully comply in all respects with the terms of said laws. 63. INDEPENDENT CONTRACTOR Development Manager, its employees, agents or representatives, shall be deemed to be independent contractors and not agents or employees of the City and shall not attain any rights or benefits under the civil service or pension ordinances of the City, or any rights generally afforded classified or unclassified employees. Development Manager, its employees, agents or representatives, shall not be entitled to Florida Workers' Compensation benefits as an employee of the City. 64. PUBLIC RECORDS Development Manager shall comply with Chapter 119, Florida Statutes, as may be applicable, shall additionally comply with Section 119.0701, Florida Statutes, including without limitation: (1) keep and maintain public records that ordinarily and necessarily would be required by the City to perform this service; (2) provide the public with access to public records on the terms and conditions as the City would at the cost provided by Chapter 119, Florida Statutes, or as otherwise provided by law; (3) ensure that public records that are exempt or confidential and exempt from disclosure are not disclosed except as authorized by law; (4) meet all requirements for retaining public records and transfer, at no cost, to the City all public records that are exempt or confidential and exempt from disclosure requirements; (5) all electronically stored public records must be provided to the City in a format compatible with the City's information technology systems. SHOULD DEVELOPMENT MANAGER DISPUTE ANY PUBLIC ACCESS REQUIRED BY FLORIDA STATUTES, THEN DEVELOPMENT MANAGER SHALL DO SO AT ITS OWN EXPENSE AND AT NO COST TO THE CITY. IF CONTRACTOR HAS QUESTIONS REGARDING THE APPLICATION OF CHAPTER 119, FLORIDA STATUTES, TO DEVELOPMENT MANAGER'S DUTY TO PROVIDE PUBLIC RECORDS RELATING TO THIS AGREEMENT, CONTACT THE CUSTODIAN OF PUBLIC RECORDS AT (305) 416-1800, VIA EMAIL AT PUBLICRECORDS@MIAMIGOV.COM, OR REGULAR MAIL AT CITY OF MIAMI OFFICE OF THE CITY ATTORNEY, 444 SW 2ND AVENUE, 9TH FLOOR, MIAMI, FL 33130. 65. NOTICES All notices or other communications required under this Agreement shall be in writing and shall be given by hand -delivery or by registered or certified U.S. mail, return receipt requested, addressed to the other party at the address indicated herein or to such other address as a party may designate by notice 54 given as herein provided. Notice shall be deemed given on the day on which personally delivered; or, if by mail, on the fifth day after being posted or the date of actual receipt, whichever is earlier. For the City of Miami: City Manager 444 S.W. 2nd Avenue, 10th Floor Miami, FL 33130-1910 With a copy to: Director of Capital Improvements 444 S.W. 2nd Avenue, 8th Floor Miami, FL 33130-1910 For Development Manager: Coconut Grove Condo, LLC Attn: W. Spencer Morris 121 Alhambra Plaza, Ste. 1600 Coral Gables, FL 33134 Telephone: (305) 443-1000 Email: WASM@allenmorris.com 66. CITY RIGHTS AS SOVEREIGN The City is entering into this Agreement only in its proprietary (not regulatory) capacity and retains all of its sovereign prerogatives and rights and regulatory authority (quasijudicial or otherwise) as a City under all applicable laws (all of which shall be absolute and unfettered in all respects), and shall in no way be estopped from withholding or refusing to issue any approvals, licenses or permits granted by the City in its governmental capacity or applications for building, zoning, planning or development under present or future laws and regulations whatever nature applicable to the planning, design, construction and development of the AMCO Grove Project, the Project, or any other development contemplated in this Agreement, or the operation thereof. The City shall not by virtue of this Agreement or any other document associated with the development be obligated to grant or be deemed to have granted any approvals, permits or licenses by the City in its governmental capacity. Notwithstanding and prevailing over any contrary provision in this Agreement, any City obligation that may be contained herein shall not require the City or any other city, county, federal or state department or authority, committee or agency to grant or leave in effect any zoning changes, variances, Permits, zoning waivers, or any other governmental approvals that may be granted, withheld, or revoked by the City or other applicable governmental agencies, acting in their governmental capacity. In no event shall the City have any obligations or liabilities to Development Manager or any third parties under this Agreement or otherwise on account of the City's exercise of its sovereign prerogatives and rights and regulatory authority (quasi-judicial or otherwise) as a municipal government under applicable laws. Without limitation of the foregoing, nothing contained in this agreement is intended as a waiver of City's sovereign immunity as set forth under Section 768.28, Florida Statutes, or otherwise. 55 67. ANTI -HUMAN TRAFFICKING Development Manager confirms and certifies that it is not in violation of Section 787.06, Florida Statutes, and that it does not and shall not use "coercion" for labor or services as defined in Sedion 787.06, Florida Statutes. The Development Manager shall execute and submit to the City an Affidavit, of even date herewith, in compliance with Sedion 787.06(13), Florida Statutes, attached and incorporated herein as Exhibit "D". If the Development Manager fails to comply with the terms of this Sedion, the City may suspend or terminate this Agreement immediately, without prior notice, and in no event shall the City be liable to Development Manager for any compensation or expense, including, but not limited to, any consequential or incidental damages. [SIGNATURE PAGES TO FOLLOW] 56 IN WITNESS WHEREOF, the parties have se their hands and seals on the day and year first shown above: CITY City of Miami, Florida, a municipal Corporation ATTEST: By: By: Todd B. Hannon, City Clerk Arthur Noriega,V, City Manager APPROVED AS TO LEGAL FORM APPROVED AS TO INSURANCE AND CORRECTNESS: REQUIREMENTS: George Wysong, Esq. David Ruiz, Interim Director City Attorney Department of Risk Management ATTEST: Name: Title: 57 DEVELOPMENT MANAGER COCONUT GROVE CONDO, LLC, a Florida limited liability company By: Yazmin Gil, Manager PZD-5 LEGAL DESCRIPTION OF PROPERTIES Address: 3101 Grand Avenue, Miami, FL Folio No.: 01-4121-030-0020 Owner: AYME Properties, LLC Legal Description: Tract "B" of HAAS PROPERTIES, according to the Plat thereof, recorded in Plat Book 51, at Page 65 of the Public Records of Miami -Dade County, Florida. Address: 3101 Grand Avenue, Miami, FL Folio No.: 01-4121-030-0010 Owner: AYME Properties, LLC Legal Description: Tract "A" of HAAS PROPERTIES, according to the Plat thereof, recorded in Plat Book 51, at Page 65 of the Public Records of Miami -Dade County, Florida. Address: 3100 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0118 Owner: 3101 Grove Trustee, LLC Legal Description: Lot 1, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. LESS the East five (5) feet and North five (5) feet of Lot 1, Block 2, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami - Dade County, Florida, as conveyed by Warranty Deed recorded in Deed Book 3791, Page 226, re -recorded in Official Records Book 5018, Page 116 of the Public Records of Miami -Dade County, Florida. Address: 3104 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0120 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 2, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3114 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0130 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 3, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3124 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0140 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 4, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3150 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0150 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 5, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: 3158 Florida Avenue, Miami, FL Folio No.: 01-4121-032-0160 Owner: AYME Florida Avenue Properties, LLC Legal Description: Lot 6, Block 2 of CHARLES H. FROW SUBDIVISION, according to the Plat thereof, as recorded in Plat Book 13, Page 53 of the Public Records of Miami -Dade County, Florida. Address: Folio No.: Address: Folio No.: Address: Folio No.: Address: Folio No.: Address: Folio No.: Address: Folio No.: Address: Folio No.: Address: Folio No.: PZD-6 COMPLETE LIST OF ALL FOLIOS & PROPERTY ADDRESSES 3101 Grand Avenue, Miami, FL 01-4121-030-0020 3101 Grand Avenue, Miami, FL 01-4121-030-0010 3100 Florida Avenue, Miami, FL 01-4121-032-0118 3104 Florida Avenue, Miami, FL 01-4121-032-0120 3114 Florida Avenue, Miami, FL 01-4121-032-0130 3124 Florida Avenue, Miami, FL 01-4121-032-0140 3150 Florida Avenue, Miami, FL 01-4121-032-0150 3158 Florida Avenue, Miami, FL 01-4121-032-0160 4ttt1 of Tann BUILDING DEPARTMENT Transaction Statement Financial Transaction ID: 1241680 Transaction Date: Nov 7 2025 9:29AM Permit Number: PZ2520097 FEE SUMMARY Javier Avino (305)761-2274 Fee Category Fee Code Fee Description Quantity Unit Type Amount PLANNING MS-382 DEVELOPMENT AGREEMENT OR MODIFICATION OF DEVELOPMENT AGREEMENT 0.0000 N/A $8,500.00 Total: $8,500.00 Rev. Jul/02/2012 Generated on Nov/07/2025 9:29 AM 11/10/25, 3:02 PM City of Miami Payments Success. Confirmation #185812173 An email confirmation has been sent to jfernandez@smgglaw.com PAYMENT METHOD **** **** **** 1009 IX CONTACT INFORMATION Javier Fernandez 201 Alhambra Circle, Ste. 1205 Coral Gables, FL 33134 jfernandez©smgglaw.com TRANSACTION ID 1241680 Processing Fees Tota l : OPTION Balance Due AMOUNT $8,500.00 $0.00 $8,500.00 https://www.paydici.com/city-of-miami-fl/orders/682534981 /print_receipt 1/1